Property Summary

NCBI Gene PubMed Count 18
PubMed Score 44.18
PubTator Score 8.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 7.1e-07
ovarian cancer 8491 2.8e-06
Disease Target Count Z-score Confidence
Lymphoma 57 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.381 7.1e-07
ovarian cancer -1.500 2.8e-06

Gene RIF (5)

PMID Text
24272675 hHgher protein levels of ZFP91 in all cancer cell lines.
22190034 HIV-1 Tat is identified to have a physical interaction with zinc finger protein 91 homolog (ZFP91) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20804734 These data clearly indicate that ZFP91 is a key regulator in LIGHT-induced activation of non-canonical NF-kappaB pathway in LTbetaR signaling.
20682767 An atypical E3 ligase zinc finger protein 91 stabilizes and activates NF-kappaB-inducing kinase via Lys63-linked ubiquitination.
12738986 likely to play an important role in cell proliferation and/or anti-apoptosis, and may serve as a molecular marker for AML

AA Sequence

MPGETEEPRPPEQQDQEGGEAAKAAPEEPQQRPPEAVAAAPAGTTSSRVLRGGRDRGRAAAAAAAAAVSR      1 - 70
RRKAEYPRRRRSSPSARPPDVPGQQPQAAKSPSPVQGKKSPRLLCIEKVTTDKDPKEEKEEEDDSALPQE     71 - 140
VSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQLICKSEPNTDQLDYDVGEEHQSPGGISSEEE    141 - 210
EEEEEEMLISEEEIPFKDDPRDETYKPHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIRED    211 - 280
EEPPRKRGRRRKDDKSPRLPKRRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIKYQHLLKKKYVCPHPSCG    281 - 350
RLFRLQKQLLRHAKHHTDQRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMK    351 - 420
KHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEVLIAEALAANAGALITSTDILGTNPESLTQPSDGQ    421 - 490
GLPLLPEPLGNSTSGECLLLEAEGMSKSYCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEV    491 - 560
LIEDSDSAGP                                                                561 - 570
//

Text Mined References (19)

PMID Year Title
24272675 2014 ZFP91-a newly described gene potentially involved in prostate pathology.
23349640 2013 Susceptibility loci associated with specific and shared subtypes of lymphoid malignancies.
20804734 2010 Zinc-finger protein 91 plays a key role in LIGHT-induced activation of non-canonical NF-?B pathway.
20682767 2010 An atypical E3 ligase zinc finger protein 91 stabilizes and activates NF-kappaB-inducing kinase via Lys63-linked ubiquitination.
20434516 2010 A retroviral vector common integration site between leupaxin and zinc finger protein 91 (ZFP91) observed in baboon hematopoietic repopulating cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16582619 2006 Identification of novel ARF binding proteins by two-hybrid screening.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
12738986 2003 Identification of a novel human gene, ZFP91, involved in acute myelogenous leukemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11483580 2001 Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.
11361095 2001 Three classes of C2H2 zinc finger proteins.
11058868 2000 Identification of differentially expressed genes in human melanoma cells with acquired resistance to various antineoplastic drugs.
7835706 1995 A widely expressed novel C2H2 zinc-finger protein with multiple consensus phosphorylation sites is conserved in mouse and man.