Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.95
PubTator Score 12.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 2.378 2.0e-05
juvenile dermatomyositis 1.295 4.6e-11
adrenocortical carcinoma 1.326 1.2e-03
primary pancreatic ductal adenocarcinoma 1.085 4.1e-03
group 4 medulloblastoma 1.400 1.5e-04
pilocytic astrocytoma -1.100 4.3e-07
Alzheimer's disease 1.100 2.9e-02
Pick disease 1.500 1.2e-05
ovarian cancer -1.900 5.4e-06

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAPRPPTAAPQESVTFKDVSVDFTQEEWYHVDPAQRSLYRDVMLENYSHLVSLGYQVSKPEVIFKLEQGE      1 - 70
EPWISEGEIQRPFYPDWKTRPEVKSSHLQQDVSEVSHCTHDLLHATLEDSWDVSSQLDRQQENWKRHLGS     71 - 140
EASTQKKIITPQENFEQNKFGENSRLNTNLVTQLNIPARIRPSECETLGSNLGHNADLLNENNILAKKKP    141 - 210
YKCDKCRKAFIHRSSLTKHEKTHKGEGAFPNGTDQGIYPGKKHHECTDCGKTFLWKTQLTEHQRIHTGEK    211 - 280
PFECNVCGKAFRHSSSLGQHENAHTGEKPYQCSLCGKAFQRSSSLVQHQRIHTGEKPYRCNLCGRSFRHG    281 - 350
TSLTQHEVTHSGEKPFQCKECGKAFSRCSSLVQHERTHTGEKPFECSICGRAFGQSPSLYKHMRIHKRGK    351 - 420
PYQSSNYSIDFKHSTSLTQDESTLTEVKSYHCNDCGEDFSHITDFTDHQRIHTAENPYDCEQAFSQQAIS    421 - 490
HPGEKPYQCNVCGKAFKRSTSFIEHHRIHTGEKPYECNECGEAFSRRSSLTQHERTHTGEKPYECIDCGK    491 - 560
AFSQSSSLIQHERTHTGEKPYECNECGRAFRKKTNLHDHQRIHTGEKPYSCKECGKNFSRSSALTKHQRI    561 - 630
HTRNKL                                                                    631 - 636
//

Text Mined References (16)

PMID Year Title
23543754 2013 Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21284946 2011 Zinc-finger protein 90 negatively regulates neuron-restrictive silencer factor-mediated transcriptional repression of fetal cardiac genes.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15852396 2005 Spastic paraplegia, optic atrophy, and neuropathy is linked to chromosome 11q13.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.
7576184 1995 Developmentally regulated mouse gene NK10 encodes a zinc finger repressor protein with differential DNA-binding domains.