Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.95
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MALRSVMFSDVSIDFSPEEWEYLDLEQKDLYRDVMLENYSNLVSLGCFISKPDVISSLEQGKEPWKVVRK      1 - 70
GRRQYPDLETKYETKKLSLENDIYEINLSQWKIMERIENHGLKGLILKNDWESTGKIEGQERPQEGYFSS     71 - 140
VKMPSEKVSSYQKRTSVTPHQRLHFVDKPYECKECGKAFRVRQQLTFHHRIHTGEKPYECKECGMAFRQT    141 - 210
AHLTRHQRLHSGEKLYECKECGEAFICGADLRVHQKMHIGEKPYECKECGKAFRVRGQLTLHQRIHTGEK    211 - 280
PYVCKECGKAFRQYAHLTRHQKLNSADRLYECKECGKAFLCGSGLRVHHKLHTGEKPYECKECGKAFRVR    281 - 350
QQLTLHQRIHTGEKPYECKECGKTFSRGYHLILHHRIHTGEKPYECKECWKAFSRYSQLISHQSIHIGVK    351 - 420
PYDCKECGKAFRLLSQLTQHQSIHIGEKPYKCKECGKAFRLRQKLTLHQSIHTGEKPFECKECRKAFRLN    421 - 490
SSLIQHLRIHSGEKPYECKECKKAFRQHSHLTHHLKIHNVKI                                491 - 532
//

Text Mined References (9)

PMID Year Title