Property Summary

NCBI Gene PubMed Count 18
PubMed Score 26.73
PubTator Score 23.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
lung carcinoma 2844 8.8e-26
Duchenne muscular dystrophy 602 1.1e-08
juvenile dermatomyositis 1189 1.9e-08
acute quadriplegic myopathy 1157 5.5e-07
lung cancer 4473 2.4e-06
atypical teratoid / rhabdoid tumor 4369 4.2e-06
ovarian cancer 8491 5.4e-06
psoriasis 6685 5.4e-06
pediatric high grade glioma 2712 7.2e-06
glioblastoma 5572 1.0e-05
pituitary cancer 1972 1.2e-05
pilocytic astrocytoma 3086 1.2e-05
Amyotrophic Lateral Sclerosis 432 4.7e-05
osteosarcoma 7933 6.1e-05
primitive neuroectodermal tumor 3031 1.1e-04
astrocytoma 1493 1.8e-04
invasive ductal carcinoma 2950 1.8e-04
limb girdle muscular dystrophy 2I 56 3.7e-04
fascioscapulohumeral muscular dystrophy 100 4.5e-04
inflammatory breast cancer 404 5.0e-04
group 4 medulloblastoma 1875 6.2e-04
medulloblastoma, large-cell 6234 6.3e-04
oligodendroglioma 2849 6.7e-04
ependymoma 2514 1.7e-03
COPD 116 1.7e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 499 2.1e-03
pancreatic cancer 2300 5.0e-03
adrenocortical carcinoma 1427 5.0e-03
primary pancreatic ductal adenocarcinoma 1271 6.9e-03
ductal carcinoma in situ 1745 7.2e-03
Becker muscular dystrophy 187 7.9e-03
gastric carcinoma 832 1.1e-02
chronic rhinosinusitis 512 1.3e-02
cystic fibrosis and chronic rhinosinusitis 213 1.4e-02
Rheumatoid Arthritis 1170 1.6e-02
active Crohn's disease 918 1.7e-02
esophageal adenocarcinoma 737 1.8e-02
intraductal papillary-mucinous adenoma (IPMA) 2956 1.8e-02
Down syndrome 548 1.9e-02
Waldenstrons macroglobulinemia 764 3.1e-02
chronic lymphosyte leukemia 232 3.3e-02
subependymal giant cell astrocytoma 2287 3.5e-02
aldosterone-producing adenoma 664 4.8e-02

Expression

  Differential Expression (43)

Disease log2 FC p
Rheumatoid Arthritis 1.800 1.6e-02
Waldenstrons macroglobulinemia 1.143 3.1e-02
astrocytoma 3.000 1.8e-04
ependymoma 3.200 1.7e-03
oligodendroglioma 2.200 6.7e-04
esophageal adenocarcinoma 1.500 1.8e-02
glioblastoma 3.500 1.0e-05
osteosarcoma 2.819 6.1e-05
chronic lymphosyte leukemia -1.600 3.3e-02
atypical teratoid / rhabdoid tumor 3.100 4.2e-06
medulloblastoma, large-cell 1.100 6.3e-04
primitive neuroectodermal tumor 2.000 1.1e-04
Duchenne muscular dystrophy 1.849 1.1e-08
limb girdle muscular dystrophy 2I 1.229 3.7e-04
autosomal dominant Emery-Dreifuss muscul... 1.665 2.1e-03
Becker muscular dystrophy 1.115 7.9e-03
fascioscapulohumeral muscular dystrophy 1.014 4.5e-04
juvenile dermatomyositis 1.130 1.9e-08
Amyotrophic Lateral Sclerosis 1.185 4.7e-05
acute quadriplegic myopathy 2.227 5.5e-07
adrenocortical carcinoma -1.107 5.0e-03
primary pancreatic ductal adenocarcinoma 1.540 6.9e-03
intraductal papillary-mucinous adenoma (... 1.100 1.8e-02
lung cancer -2.500 2.4e-06
active Crohn's disease -3.081 1.7e-02
pediatric high grade glioma 2.900 7.2e-06
group 4 medulloblastoma -1.200 6.2e-04
pilocytic astrocytoma 2.400 1.2e-05
aldosterone-producing adenoma -1.296 4.8e-02
subependymal giant cell astrocytoma 1.741 3.5e-02
psoriasis -1.300 5.4e-06
inflammatory breast cancer -1.400 5.0e-04
COPD -1.700 1.7e-03
lung carcinoma -1.800 8.8e-26
gastric carcinoma 1.700 1.1e-02
ductal carcinoma in situ -1.400 7.2e-03
invasive ductal carcinoma -1.200 1.8e-04
ovarian cancer 1.900 5.4e-06
pituitary cancer -1.600 1.2e-05
Down syndrome 1.100 1.9e-02
chronic rhinosinusitis -1.286 1.3e-02
cystic fibrosis and chronic rhinosinusit... -1.150 1.4e-02
pancreatic cancer 1.600 5.0e-03

Gene RIF (8)

PMID Text
25809263 Study of the role of the C-terminal residues in the structure of unbound TIS11d, the E220A mutant and the truncation mutant lacking the last two residues (D219/E220) using molecular dynamics, NMR spectroscopy, and biochemical methods
21509594 ZFP36L2 gene expression is decreased in both classic and follicular variants of papillary thyroid carcinoma.
21278925 The roles of TTP and BRF proteins in regulated mRNA decay.
21109922 Data suggest that the dysregulation of TIS11D function is associated with the pathogenesis of certain types of leukemia.
20506496 Multiple nanosecond timescale molecular dynamics trajectories of TIS11d wild-type and E157R/E195K mutant with different RNA sequences were performed to investigate the molecular basis for RNA binding specificities of this TZF domain.
17172869 These data suggest TIS11D as a candidate p53 target gene that may be part of the network of genes responsible for p53-dependent apoptosis.
14981510 Sequence specificity in RNA recognition is achieved by a network of intermolecular hydrogen bonds, mostly between TIS11d main-chain functional groups and the Watson-Crick edges of the bases
14604009 polymorphisms sequenced in genomic DNA encoding the TTP protein (ZFP36) and those of its two known mammalian relatives, ZFP36L1 and ZFP36L2, from 72 to 92 anonymous human subjects from various geographical and ethnic backgrounds

AA Sequence

MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASNLHALAHPAPS      1 - 70
PGSCSPKFPGAANGSSCGSAAAGGPTSYGTLKEPSGGGGTALLNKENKFRDRSFSENGDRSQHLLHLQQQ     71 - 140
QKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGP    141 - 210
RCHFIHNADERRPAPSGGASGDLRAFGTRDALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLL    211 - 280
DSPTSRTPPPPSCSSASSCSSSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPC    281 - 350
AACSSASCANNAFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQQGLAPPAQPPAPPSATLPAG    351 - 420
AAAPPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDPGRRLPIFSRLS    421 - 490
ISDD                                                                      491 - 494
//

Text Mined References (25)

PMID Year Title
27182009 2016 Functional analysis of ZFP36 proteins in keratinocytes.
25809263 2015 Probing the structural and dynamical effects of the charged residues of the TZF domain of TIS11d.
25106868 2014 ZFP36L1 and ZFP36L2 control LDLR mRNA stability via the ERK-RSK pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21278925 The roles of TTP and BRF proteins in regulated mRNA decay.
21151128 2011 Genome-wide association study identifies susceptibility loci for polycystic ovary syndrome on chromosome 2p16.3, 2p21 and 9q33.3.
21109922 2011 Mutation in the RNA binding protein TIS11D/ZFP36L2 is associated with the pathogenesis of acute leukemia.
20506496 2010 A computational study of RNA binding and specificity in the tandem zinc finger domain of TIS11d.
20166898 2010 ZFP36L1 is regulated by growth factors and cytokines in keratinocytes and influences their VEGF production.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17172869 2006 TIS11D is a candidate pro-apoptotic p53 target gene.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14981510 2004 Recognition of the mRNA AU-rich element by the zinc finger domain of TIS11d.
14604009 2003 Polymorphisms in the genes encoding members of the tristetraprolin family of human tandem CCCH zinc finger proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10367403 1998 Differential effects of sodium butyrate on the transcription of the human TIS11 family of early-response genes in colorectal cancer cells.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8545129 1995 Identification of a member of the TIS11 early response gene family at the insertion point of a DNA fragment containing a gene for the T-cell receptor beta chain in an acute T-cell leukemia.
7835719 1995 ERF-2, the human homologue of the murine Tis11d early response gene.