Property Summary

NCBI Gene PubMed Count 43
PubMed Score 36.31
PubTator Score 27.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
astrocytoma 3.200 9.9e-04
ependymoma 2.400 3.5e-02
oligodendroglioma 1.400 4.4e-02
psoriasis -3.600 4.0e-06
glioblastoma 3.400 1.1e-06
osteosarcoma -2.962 5.4e-10
group 4 medulloblastoma -2.700 4.9e-08
cystic fibrosis 1.323 1.7e-04
atypical teratoid / rhabdoid tumor 3.200 5.9e-09
medulloblastoma, large-cell -2.000 2.2e-02
primitive neuroectodermal tumor 1.500 7.3e-03
Duchenne muscular dystrophy 1.612 1.1e-05
autosomal dominant Emery-Dreifuss muscul... 2.133 1.1e-03
fascioscapulohumeral muscular dystrophy 1.254 1.6e-03
juvenile dermatomyositis 1.703 3.5e-11
Amyotrophic Lateral Sclerosis 1.389 6.6e-05
acute quadriplegic myopathy 1.866 7.4e-05
pancreatic ductal adenocarcinoma liver m... 1.135 3.0e-02
lung cancer -1.500 1.3e-04
pediatric high grade glioma 2.300 1.6e-04
pilocytic astrocytoma 1.800 1.8e-03
aldosterone-producing adenoma -1.512 3.2e-02
lung carcinoma -1.900 5.3e-26
Alzheimer's disease 1.500 1.6e-02
Pick disease 1.500 3.8e-03
gastric carcinoma 1.300 4.0e-02
ulcerative colitis 1.700 1.1e-03
ovarian cancer -1.700 1.5e-06
pituitary cancer -2.200 2.4e-07
Down syndrome 1.400 7.0e-03

Gene RIF (13)

PMID Text
26542173 A ZFP36L1-mediated regulatory circuit through repressing CDK6 expression.
25670004 Gene expression analysis revealed that three gene BACH2, PTGER4 and ZFP36L1, are down-regulated in MS patients' blood cells compared to healthy subjects.
25014217 ZFP36L1 interacts with and mediates degradation of anti-apoptotic BCL2 mRNA as its important target in malignant B-cells.
24700863 regulator of renal mineralocorticoid receptor abundance
24086717 NR4A2 expression is negatively regulated by zinc finger protein 36, C3H1 type-like 1 (Zfp36l1).
21278925 The roles of TTP and BRF proteins in regulated mRNA decay.
20702587 ZFP36L1 negatively regulates erythroid differentiation by directly binding the 3' untranslated region of Stat5b encoding mRNA.
20166898 these results suggest an important role of ZFP36L1 in wound healing.
19801654 Von Hippel-Lindau gene product modulates TIS11B expression in renal cell carcinoma and has a role in vascular endothelial growth factor expression in hypoxia
19417105 crystal structures of human and S. pombe eRF1 in complex with eRF3 lacking the GTPase domain revealed details of the interaction between these two factors and marked conformational changes in eRF1 that occur upon binding to eRF3
19092855 Tis11b, an AU-rich binding protein induces apoptosis by rituximab in B cell chronic lymphocytic leukemia cells.
15465005 Data suggest an important role for butyrate response factor-1 in osteoblasts within the molecular network of parathyroid hormone-dependent bone remodeling.
14604009 polymorphisms sequenced in genomic DNA encoding the TTP protein (ZFP36) and those of its two known mammalian relatives, ZFP36L1 and ZFP36L2, from 72 to 92 anonymous human subjects from various geographical and ethnic backgrounds

AA Sequence

MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSS      1 - 70
LKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHG     71 - 140
IHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSA    141 - 210
AATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFR    211 - 280
PMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD                281 - 338
//

Text Mined References (50)

PMID Year Title
27182009 2016 Functional analysis of ZFP36 proteins in keratinocytes.
26542173 2015 ZFP36L1 promotes monocyte/macrophage differentiation by repressing CDK6.
25670004 2015 Anti-inflammatory genes associated with multiple sclerosis: a gene expression study.
25106868 2014 ZFP36L1 and ZFP36L2 control LDLR mRNA stability via the ERK-RSK pathway.
25014217 2014 Post-transcriptional regulation of BCL2 mRNA by the RNA-binding protein ZFP36L1 in malignant B cells.
24700863 2014 Hypertonicity compromises renal mineralocorticoid receptor signaling through Tis11b-mediated post-transcriptional control.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086717 2013 NR4A2 is regulated by gastrin and influences cellular responses of gastric adenocarcinoma cells.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21832157 2011 A novel function of Tis11b/BRF1 as a regulator of Dll4 mRNA 3'-end processing.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21278925 The roles of TTP and BRF proteins in regulated mRNA decay.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
20702587 2010 ZFP36L1 negatively regulates erythroid differentiation of CD34+ hematopoietic stem cells by interfering with the Stat5b pathway.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20166898 2010 ZFP36L1 is regulated by growth factors and cytokines in keratinocytes and influences their VEGF production.
19801654 2009 Von Hippel-Lindau gene product modulates TIS11B expression in renal cell carcinoma: impact on vascular endothelial growth factor expression in hypoxia.
19430480 2009 Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes.
19417105 2009 Structural insights into eRF3 and stop codon recognition by eRF1.
19179481 2009 cAMP-dependent posttranscriptional regulation of steroidogenic acute regulatory (STAR) protein by the zinc finger protein ZFP36L1/TIS11b.
19092855 2009 Involvement of Tis11b, an AU-rich binding protein, in induction of apoptosis by rituximab in B cell chronic lymphocytic leukemia cells.
18418350 2008 Transcription factor HNF1beta and novel partners affect nephrogenesis.
18326031 2008 The AU-rich element mRNA decay-promoting activity of BRF1 is regulated by mitogen-activated protein kinase-activated protein kinase 2.
17369404 2007 TTP and BRF proteins nucleate processing body formation to silence mRNAs with AU-rich elements.
17030608 2006 BRF1 protein turnover and mRNA decay activity are regulated by protein kinase B at the same phosphorylation sites.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15967811 2005 Stress granules and processing bodies are dynamically linked sites of mRNP remodeling.
15713487 2005 Thermodynamic and structural equivalence of two HLA-B27 subtypes complexed with a self-peptide.
15687258 2005 Recruitment and activation of mRNA decay enzymes by two ARE-mediated decay activation domains in the proteins TTP and BRF-1.
15538381 2004 The ARE-dependent mRNA-destabilizing activity of BRF1 is regulated by protein kinase B.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467755 2004 Destabilization of vascular endothelial growth factor mRNA by the zinc-finger protein TIS11b.
15465005 2004 Butyrate response factor 1 is regulated by parathyroid hormone and bone morphogenetic protein-2 in osteoblastic cells.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14604009 2003 Polymorphisms in the genes encoding members of the tristetraprolin family of human tandem CCCH zinc finger proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198173 2002 Functional cloning of BRF1, a regulator of ARE-dependent mRNA turnover.
10367403 1998 Differential effects of sodium butyrate on the transcription of the human TIS11 family of early-response genes in colorectal cancer cells.
8898945 1996 Distinct mechanisms for rescue from apoptosis in Ramos human B cells by signaling through CD40 and interleukin-4 receptor: role for inhibition of an early response gene, Berg36.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8595910 1995 The human immediate early gene BRF1 maps to chromosome 14q22-q24.
8346037 1993 Coding sequence of ERF-1, the human homologue of Tis11b/cMG1, members of the Tis11 family of early response genes.
8024689 1994 Cloning and characterization of ERF-1, a human member of the Tis11 family of early-response genes.