Property Summary

NCBI Gene PubMed Count 158
PubMed Score 220.26
PubTator Score 167.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
nephrosclerosis -1.226 4.2e-05
urothelial carcinoma -1.700 5.9e-04
psoriasis -2.100 4.7e-08
astrocytoma 2.000 4.2e-04
glioblastoma 2.300 1.2e-03
non diabetic and post-ischemic heart fai... -1.200 1.2e-02
adrenocortical carcinoma -1.553 6.7e-04
primary pancreatic ductal adenocarcinoma 2.161 2.9e-03
non-small cell lung cancer -2.149 1.4e-22
intraductal papillary-mucinous adenoma (... -1.100 6.6e-03
lung cancer -5.300 3.2e-07
colon cancer -2.000 9.2e-03
breast carcinoma -1.200 3.8e-03
fibroadenoma -1.900 1.5e-02
lung adenocarcinoma -1.400 4.4e-04
group 4 medulloblastoma -1.300 5.5e-04
aldosterone-producing adenoma -1.467 4.5e-02
inflammatory breast cancer -3.100 3.7e-08
lung carcinoma -2.900 1.8e-15
mucosa-associated lymphoid tissue lympho... 1.111 1.7e-02
acute myeloid leukemia 2.000 2.9e-02
pituitary cancer -2.500 5.0e-06
pancreatic cancer 2.100 2.1e-03

Gene RIF (127)

PMID Text
26820662 PP2A activators boost the anti-inflammatory function of TTP and have implications for future pharmacotherapeutic strategies to combat inflammation in respiratory disease.
26644407 Involvement of LARP4 as a target of TNF-alpha-TTP regulation provides a clue as to how its functional activity may be used in a physiologic pathway.
26551835 The mRNA destabilizing activity of TTP was increased when the partially disordered RNA binding domain (RBD) of TTP was replaced with the fully structured RBD of TIS11d, indicating that differences in the folded state of the RBD affect the activity of the proteins in the cell.
26546680 DUSP1 overexpression and inhibition of MAPKs prevented IL1B-induced expression of ZFP36, this was associated with increased TNF mRNA expression at 6 h, an effect that was predominantly due to elevated transcription.
26517838 TTP might regulate interleukin (IL)-6 and IL-18 expression in diabetes. Diabetes with clinical proteinuria is accompanied by decreased urinary and serum level of TTP mRNA and protein, and increased levels of IL-6 and IL-18 mRNA and protein.
26497679 Tristetraprolin induces cell cycle arrest in breast tumor cells by targeting AP-1/c-Jun and NF-kappaB/RelA pathway.
26486958 TTP-dependent regulatory pathway described herein likely contributes to the role of IL-22 in inflammation and cancer and may evolve as novel target for pharmacological IL-22 modulation.
26370510 Tristetraprolin (TTP) recruits eukaryotic initiation factor 4E2 (eIF4E2) to repress target mRNA translation.
26356262 Results suggest that miR-29a acts as an oncogene by down regulating TTP and suggest the potential of miR-29a and TTP as biomarkers.
26125882 Logistic regression analyses demonstrated that TNF-alpha and the three ZFP36 gene polymorphisms were not independently associated with obstructive sleep apnea.
26062599 Modulation of TAFI levels by pro-inflammatory mediators or lipopolysaccharide involves binding of tristetraprolin to the CPB2 3'-UTR, which mediates CPB2 mRNA destabilisation.
25955820 In this review we summarize current progress regarding the specific characteristics of sequences and structures in the 3' untranslated regions of mRNAs that are recognized by tristetraproline, Roquins, and Regnase-1.
25943894 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of tristetraprolin
25939870 ZFP36 controls RIP1 levels in glioma neural stem cell lines.
25832634 TGF-beta decreases the stability of IL-18-induced IFN-gamma mRNA through the expression of TGF-beta-induced tristetraprolin in KG-1 cells
25762736 TTP mediates the cleavage of the 3' UTRs of stress response mRNAs by recruiting the HSV-1 VHS RNase to the AU-rich elements.
25724669 the biphasic nature of TNF-alpha-induced IL-6 mRNA expression was regulated temporally by the RNA-destabilizing molecule, TTP.
25604244 Low levels of TTP is associated with cisplatin-resistance in head and neck cancer.
25452305 Inactivation of tristetraprolin in chronic hypoxia provokes the expression of cathepsin B
25111853 Tristetraprolin is involved in the glucocorticoid-mediated interleukin 8 repression
25056949 Data indicate tristetraprolin (TTP) promotes apoptosis of HeLa cervical cancer cells in the presence of tumor necrosis factor.
25043949 The abnormalities were screened by FISH in 44 epithelioid hemangioma (EH) from different locations with seven additional EH revealing FOSB gene rearrangements, all except one being fused to ZFP36.
25038453 CNOT7/hCAF1 is involved in ICAM-1 and IL-8 regulation by TTP in HPMEC.
24978456 hnRNP F is a co-factor in a subset of tristetraprolin/BRF1/BRF2-mediated mRNA decay.
24780075 An association with Graves ophthalmopathy was shown with two SNPs in ZFP36.
24737323 TTP acts as a bona fide ERalpha corepressor and suggest that this protein may be a contributing factor in the development of E2-dependent tumors in breast cancer.
24401661 ZFP36 preferentially binds to 3' UTRs of mRNAs encoding regulators of gene expression.
24253039 although the majority of conserved residues within the TZF domain of TTP are required for productive binding, not all residues at sequence-equivalent positions in the two zinc fingers of the TZF domain of TTP are functionally equivalent.
24150491 These results demonstrate that E2F1 mRNA is a physiological target of TTP and suggests that TTP controls proliferation as well as migration and invasion through the regulation of E2F1 mRNA stability.
23744329 ZFP36 gene is not associated with HDL-C in Uygur people from Xinjiang
23644599 Authors identify an evolutionarily conserved C-terminal motif in human TTP that directly binds a central domain of CNOT1, a core subunit of the CCR4-NOT complex.
23595149 Tristetraprolin provides an important link between p53 activation induced by DNA damage and let-7 biogenesis.
23583445 TTP directly binds to the AHRR 3'UTR.TTP acts as a negative regulator of AHRR and may affect tumor development through induction of tumor suppressor genes.
23525947 Reduced tristetraprolin function through phosphorylation is associated with malignant glioma.
23401122 The TTP:HuR mRNA ratios were also perturbed in samples from invasive breast cancer patients when compared with normal tissues, and were associated with invasion gene expression.
23349315 Loss of TTP promotes invasion in head and neck cancer via transcript stabilization and secretion of MMP9, MMP2, and IL-6.
23269677 analysis of post-transcriptional regulation of meprin alpha by the RNA-binding proteins Hu antigen R (HuR) and tristetraprolin (TTP)
23241166 the loss of TTP in tumors not only affects tumor cell proliferation and survival but also enhances infiltration of monocytes/macrophages into the tumors, which is typically associated with poor prognosis
23212617 These results suggested that during LPS stimulation, NF-kappaB signaling were activated to regulate the transcription of TTP mRNA.
23030431 MKP-1 suppressed Tristetraprolin expression by inhibiting p38 MAPK pathway.
22968621 Tristetraprolin is highly expressed in the normal mammary epithelium, while its downregulation frequently accompanies tumorigenesis.
22960231 Tristetraproline (TTP) is an RNA-binding protein that may be involved in ARE-mediated degradation of parathyroid hormone-related protein.
22918951 TTP-driven HIF-1alpha mRNA stabilization is crucial for cell migration.
22907529 Through its ability to attenuate TTP gene expression, the ZFP36*2 A > G gene polymorphism has appeared as a novel prognostic breast cancer marker in Caucasian patients.
22865915 Expression of IL-10 is regulated posttranscriptionally by RNA-binding protein tristetraprolin (TTP), which destabilizes IL-10 mRNA in activated macrophages.
22863009 TTP suppression is a hallmark of cancers with MYC involvement, and restoring TTP impairs Myc-induced lymphomagenesis and abolishes maintenance of the malignant state.
22700982 TTP post-transcriptionally down-regulates Pim-1 expression and that the overexpression of TTP may contribute to tumor suppression in part by down-regulating Pim-1 expression.
22544323 New ZFP36 targets are the kinases PIM1 and PIM3 and X-linked inhibitor of apoptosis protein (XIAP).
22452791 Suggest a role for tristetraprolin in constitutive, and perhaps regulated, control of TAFI mRNA stability and hence abundance.
22433566 EGF activates TTP expression by activation of ELK-1 and EGR-1 transcription factors.
22428029 ZFP36 may be an important target for anti-inflammatory therapy during chronic hepatitis B virus infection.
22426177 It was demonstrated for the first time that HuR post-transcriptionally regulates IL-6 expression mainly via tristetraprolin in human pulmonary microvascular endothelial cells. Tristetraprolin had no effect on HuR expression and subcellular localization.
22387927 We survey potential mechanisms that cells may employ to suppress TTP expression in cancer.
22268119 The results suggest that in human pulmonary microvascular endothelial cells, MAP-kinase-activated kinase 2 regulates TNF-alpha-induced expression of ICAM-1 and IL-8 via tristetraprolin at the mRNA decay level.
22210895 Lin28 mRNA contains ARE within its 3'-UTR and TTP enhances the decay of Lin28 mRNA through binding to its 3'-UTR.
22203679 the ability of AUF1 isoforms to regulate the mRNA binding and decay-promoting activities of TTP
22203041 a novel function of TTP in repressing AU-rich mRNA translation; RCK is a functional partner of TTP in promoting TTP-mediated translational repression
22138182 tristetraprolin bound directly to the IL-17 mRNA 3'UTR and enhanced decay of IL-17 transcripts.
21964062 Protor-2 associates with tristetraprolin (TTP) to accelerate TTP-mediated mRNA turnover and functionally links the control of TTP-regulated mRNA stability to mTORC2 activity
21875902 These data underline the importance of synonymous variants on gene expression and the potential role of TTP genetic polymorphisms as a prognostic marker for breast cancer.
21830391 TTP inhibits the expression of both VEGF and COX-2 and reduced expression of TTP may be responsible for the increased expression of COX-2 and VEGF in human colorectal cancer.
21818148 Data reveal important and cell type-specific modulators of Zfp36 expression in adipocytes and macrophages and identify Zfp36 as a potent repressor of adipocyte-derived IL-6.
21784977 our data indicate that the interaction between TTP and CCL3 mRNA plays an important role in modulating localized inflammatory processes in tissues that are dissociated from the systemic manifestations of chronic inflammation.
21775632 TTP physiologically controls the expression of a panel of HIF-1alpha target genes. These data reveal a new role for TTP in the control of gene expression during the response of endothelial cell to hypoxia.
21656745 study demonstrated that down-regulation of TTP in head and neck squamous cell carcinoma enhances mRNA stability and promotes secretion of IL-6, vascular endothelial growth factor, and prostaglandin E2
21611196 These results indicate that miR-346 controls TNF-alpha synthesis by regulating TTP expression.
21606497 the involvement of TTP in the cholinergic anti-inflammatory cascade consisting of nicotine-STAT3-TTP-dampening inflammation.
21593445 Loss of TTP represents a key event in the establishment of melanomas through constitutive expression of CXCL8, which constitutes a potent therapeutic target.
21507959 CK2 enhances the protein level and activity of TTP via the modulation of the MKP-1-p38 MAPK signaling pathway; TGF-beta1 enhances the activity of CK2
21278925 The roles of TTP and BRF proteins in regulated mRNA decay.
21078877 Data suggest that phosphorylation of tristetraprolin by MK2 primarily affects mRNA decay downstream of RNA binding by preventing recruitment of the deadenylation machinery.
20828164 vitamin E imparts a distinct conformation on TTP that is associated with localization to a specific cellular compartment, where the protein is less susceptible to proteasomal degradation.
20691152 TTP can bind to the 2nd AU-rich elements of cIAP2 mRNA 3'UTR and destabilize cIAP2 mRNA by forming complexes with Dcp2 and Xrn1.
20498646 Tristetraprolin regulates an important subset of cancer-related genes that are involved in cellular growth, invasion and metastasis.
20335167 LATS2 tumor suppressor gene is regulated by tristetraprolin
20221403 CIN85 binding to a C-terminal motif within hTTP leads to the increased phosphorylation of hTTP, possibly through enhanced association with MEKK4
20157568 Findings demonstrate the ability of TTP to act as a tumor suppressor by inhibiting the E6-AP pathway and indicate TTP loss to be a critical event during HPV-mediated cervical cancer carcinogenesis.
20042592 The 3' untranslated region of CXCL1 contains an AUUUA-free segment that provides tristetraprolin-independent instability, which can be markedly stabilized in response to stimulation with IL-17.
20038433 Abrogation of the post-transcriptional regulation of c-Myc via methylation of a specific single CpG site in the TTP promoter presents a novel mechanism for the gain of selective resistance to the antiproliferative signaling of TGF-beta1 in liver neoplasms
19995385 TTP, an RNA-binding protein involved in IL-8 mRNA decay, became hypophosphorylated in anthrax lethal toxin (LeTx)-treated cells and knock-down of TTP prevented LeTx from destabilizing the IL-8 transcript.
19962963 Tristetraprolin is a modulator of HIF-1alpha expression during hypoxia and may play a physiological role in regulation between cellular adaptation and apoptosis in prolonged hypoxia.
19697322 TTP acts as a negative regulator of VEGF gene expression in colon cancer cells
19654331 attenuation of NF-kappaB activity is at least in part due to an interference of TTP with the nuclear import of the p65 subunit of the transcription factor
19363120 enhanced stability of IL-8 mRNA in TTP-deficient cystic fibrosis lung epithelial cells serve to drive the proinflammatory cellular phenotype in the lung
19258311 Tristetraprolin plays an important role in turning off IFN-gamma expression at the appropriate time during an immune response
18814951 downregulation of antiinflammatory factors, such as TNFAIP3, KLF2, ZFP36, and BTG1, seems to be involved in acceleration of immune response, thus exacerbation of acute GVHD.
18536977 the disease duration in Rheuamtoid arthritis patients with Tristetraprolin (TTP) genotype GG was shorter than that of patients with genotypes AA/AG
18367721 identified six MHC Class I alleles, five MHC Class II alleles, seven chemokine and chemokine receptor genes, indoleamine 2,3 dioxygenase, and CD86 as putative TTP ligands in dendritic cells
18250465 Tristetraprolin predominantly regulates CXCL1/KC chemokine mRNA decay in mononuclear phagocytes, acting via multiple 3'-untranslated region-localized adenine-uridine-rich elements.
17893259 ZFP36 gene expression in omental adipose tissue, but not in abdominal s.c. fat, may offer partial protection against the development of insulin resistance and diabetes.
17855506 Tristetraprolin might represent a novel antiangiogenic and antitumor agent acting through its destabilizing activity on vascular endothelial growth factor mRNA
17606294 These data establish that TTP mediated TNF-alpha mRNA decay is inhibited by the combined activation of ERK and p38 and not by p38 activation alone
17599736 Positive correlations between tristetraprolin gene expression in patients with rheumatoid and healthy persons.
17546847 ZFP36 is a promising cadidate gene for obesity-associated metabolic complications.
17517366 the present study, we developed a real-time PCR assay for all three human family members that allowed for comparative measurements of all three family members in the same tissues and cells.
17369404 depletion of endogenous TTP and BRF-1 proteins, or overexpression of dominant-negative mutant TTP proteins, impairs the localization of reporter AU-rich element mRNAs
16935542 These results suggest that tristetraprolin is a regulator of HIV-1 replication and enhances splicing by direct binding to AU-rich sequence of HIV-1 RNAs.
16820934 Results describe the gene expression of tristetraprolin, T-cell intracellular antigen and Hu antigen R in synovial tissues from rheumatoid arthritis and osteoarthritis patients.
16614304 Knockdown of TTP increased both cognate macrophage gene mRNAs and inflammatory tumor necrosis factor protein release. Overexpression of TTP resulted in decreased levels of the same genes supporting its role in regulating macrophage gene expression.
16596264 Results suggest that TTP may be a potential target for new therapies against Rheumatoid Arthritis.
16546352 Observational study of gene-disease association. (HuGE Navigator)
16364915 Data suggest that multiple proteins involved in human decapping are important subunits of processing bodies and are activated on ARE-mRNAs by the protein TTP.
16262601 The identification of multiple phosphorylation sites in TTP in mammalian cells is reported; this should provide the molecular basis for further studies on the function and regulation of TTP in controlling pro-inflammatory cytokines.
15778452 tristetraprolin positively regulates human inducible nitric oxide synthetase (iNOS) expression by enhancing the stability of human iNOS mRNA.
15535838 Review. The structure, genetic variants, and role of TTP (especially in TNF-alpha and Gm-CSF mRNA degradation) are discussed.
15504035 A model is supported in which each subunit of the tristetraprolin (TTP) tetramer binds to one of the five overlapping UUAUUUAUU sequences of the AU-rich element (ARE), resulting in a stable TTP-ARE complex.
15280467 HSV-1 virion host shutoff protein dependent degradation of AU-rich element-containing RNAs correlates with the transactivation, cytoplasmic accumulation, and persistence of tristetraprolin in infected cells.
15187101 TTP regulates its own expression in a manner identical to that seen with the TNF-alpha 3' untranslated region, indicating that this autoregulation is mediated at the level of mRNA stability.
15187092 stability of tristetraprolin mRNA is regulated by mitogen-activated protein kinase p38 and by tristetraprolin itself
15170914 Inappropriate TTP production may be one factor that contributes to higher rheumatoid arthritis disease activity.
15117938 the zinc finger domain of tristetraprolin requires specific RNA sequence elements for high affinity binding
15067324 Altered mRNA expression is associated with prostate cancer recurrence.
15014438 mechanism by which the p38-MAPK/MAPKAP kinase-2 kinase cascade inhibits TTP-mediated degradation of AU-rich element-containing transcripts
14766228 TTP localization is regulated by interaction with Nup214
14604009 polymorphisms sequenced in genomic DNA encoding the TTP protein (ZFP36) and those of its two known mammalian relatives, ZFP36L1 and ZFP36L2, from 72 to 92 anonymous human subjects from various geographical and ethnic backgrounds
12823857 Regulation and localization of tristetraprolin in leukocytes.
12754205 tristetraprolin is transcriptionally regulated by transforming growth factor-beta in human T cells
12751757 TTP binds to COX-2 3'UTR between nucleotides 3125 and 3432 and is expressed in HCA-7 tumor cell line
12748283 Results show that tristetraprolin can promote the deadenylation of AU-rich element (ARE)-containing, polyadenylated substrates by poly(A) RNase.
12646273 TTP can be phosphorylated by JNK as well as by the other members of the greater MAP kinase family
12639954 characteristics of interaction of tandem zinc finger peptide with AU-rich element-containing RNA substrates
12578839 Tristetraprolin binds to the 3'-untranslated region of cyclooxygenase-2 mRNA
12578825 TTP is a functional PAI-2 ARE-binding protein that modulates the post-transcriptional regulation of the PAI-2 gene
12515557 The three-dimensional solution structure of the first domain of Nup475 has been determined by multidimensional nuclear magnetic resonance spectroscopy, revealing a novel fold around a central zinc ion.
12440952 TTP can accomplish accelerated mRNA degradation [review]
12115244 is likely to function in the posttranscriptional regulation of TNFalpha.
11886850 TTP and the related proteins bind specifically to 14-3-3 proteins and 14-3-3 isoforms preferentially bind to different phosphorylated TTP species. 14-3-3 binding is one of multiple mechanisms that localize TTP to the cytoplasm.

AA Sequence

MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWV      1 - 70
PPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHP     71 - 140
KYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSS    141 - 210
SSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSD    211 - 280
PDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE                            281 - 326
//

Text Mined References (171)

PMID Year Title
27193233 2016 Destabilization of the ornithine decarboxylase mRNA transcript by the RNA-binding protein tristetraprolin.
27182009 2016 Functional analysis of ZFP36 proteins in keratinocytes.
26926077 2016 Interaction with Pyruvate Kinase M2 Destabilizes Tristetraprolin by Proteasome Degradation and Regulates Cell Proliferation in Breast Cancer.
26820662 2016 Activating protein phosphatase 2A (PP2A) enhances tristetraprolin (TTP) anti-inflammatory function in A549 lung epithelial cells.
26644407 2015 LARP4 Is Regulated by Tumor Necrosis Factor Alpha in a Tristetraprolin-Dependent Manner.
26551835 2016 Three Residues Make an Evolutionary Switch for Folding and RNA-Destabilizing Activity in the TTP Family of Proteins.
26546680 2016 Negative Feed-forward Control of Tumor Necrosis Factor (TNF) by Tristetraprolin (ZFP36) Is Limited by the Mitogen-activated Protein Kinase Phosphatase, Dual-specificity Phosphatase 1 (DUSP1): IMPLICATIONS FOR REGULATION BY GLUCOCORTICOIDS.
26517838 2015 The Expression of Tristetraprolin and Its Relationship with Urinary Proteins in Patients with Diabetic Nephropathy.
26497679 2015 Tristetraprolin induces cell cycle arrest in breast tumor cells through targeting AP-1/c-Jun and NF-?B pathway.
26486958 2015 Tristetraprolin regulation of interleukin-22 production.
26370510 2015 Tristetraprolin Recruits Eukaryotic Initiation Factor 4E2 To Repress Translation of AU-Rich Element-Containing mRNAs.
26356262 2015 MicroRNA-29a Promotes Pancreatic Cancer Growth by Inhibiting Tristetraprolin.
26125882 2015 Relationship between zinc finger protein 36 (ZFP36) gene polymorphisms and obstructive sleep apnea.
26062599 2015 Pro-inflammatory cytokines reduce human TAFI expression via tristetraprolin-mediated mRNA destabilisation and decreased binding of HuR.
25955820 2015 Emerging Roles of CCCH-Type Zinc Finger Proteins in Destabilizing mRNA Encoding Inflammatory Factors and Regulating Immune Responses.
25939870 2015 ZFP36 stabilizes RIP1 via degradation of XIAP and cIAP2 thereby promoting ripoptosome assembly.
25832634 2015 TGF-? decreases the stability of IL-18-induced IFN-? mRNA through the expression of TGF-?-induced tristetraprolin in KG-1 cells.
25815583 2015 Post-transcriptional regulation of satellite cell quiescence by TTP-mediated mRNA decay.
25762736 2015 Tristetraprolin Recruits the Herpes Simplex Virion Host Shutoff RNase to AU-Rich Elements in Stress Response mRNAs To Enable Their Cleavage.
25724669 2015 Temporal regulation of cytokine mRNA expression by tristetraprolin: dynamic control by p38 MAPK and MKP-1.
25604244 2015 TTP mediates cisplatin-induced apoptosis of head and neck cancer cells by down-regulating the expression of Bcl-2.
25452305 2015 Inactivation of tristetraprolin in chronic hypoxia provokes the expression of cathepsin B.
25111853 2014 Tristetraprolin is involved in the glucocorticoid-mediated interleukin 8 repression.
25106868 2014 ZFP36L1 and ZFP36L2 control LDLR mRNA stability via the ERK-RSK pathway.
25056949 2014 Polyubiquitinated tristetraprolin protects from TNF-induced, caspase-mediated apoptosis.
25043949 2014 ZFP36-FOSB fusion defines a subset of epithelioid hemangioma with atypical features.
25038453 2014 CNOT7/hCAF1 is involved in ICAM-1 and IL-8 regulation by tristetraprolin.
24978456 2014 hnRNP F complexes with tristetraprolin and stimulates ARE-mRNA decay.
24780075 2014 Association of BTG2, CYR61, ZFP36, and SCD gene polymorphisms with Graves' disease and ophthalmopathy.
24737323 2014 Tristetraprolin represses estrogen receptor ? transactivation in breast cancer cells.
24401661 2014 Global target mRNA specification and regulation by the RNA-binding protein ZFP36.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24253039 2014 Mutational and structural analysis of the tandem zinc finger domain of tristetraprolin.
24150491 2014 Tristetraprolin regulates prostate cancer cell growth through suppression of E2F1.
23744329 2013 [Association of MK2 and ZFP36 gene polymorphisms with high density lipoprotein cholesterol in Uygur population from Hetian area of Xinjiang].
23644599 2013 Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin.
23595149 2013 Tumor suppressor p53 plays a key role in induction of both tristetraprolin and let-7 in human cancer cells.
23583445 2013 Tristetraprolin suppresses AHRR expression through mRNA destabilization.
23525947 2013 Mutant tristetraprolin: a potent inhibitor of malignant glioma cell growth.
23401122 2013 miR-29a inhibition normalizes HuR over-expression and aberrant AU-rich mRNA stability in invasive cancer.
23349315 2013 Inactivation or loss of TTP promotes invasion in head and neck cancer via transcript stabilization and secretion of MMP9, MMP2, and IL-6.
23269677 2013 Post-transcriptional regulation of meprin ? by the RNA-binding proteins Hu antigen R (HuR) and tristetraprolin (TTP).
23241166 2013 Depletion of tristetraprolin in breast cancer cells increases interleukin-16 expression and promotes tumor infiltration with monocytes/macrophages.
23212617 2013 Transcriptional regulation of tristetraprolin by NF-?B signaling in LPS-stimulated macrophages.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23030431 2012 Regulation of tristetraprolin expression by mitogen-activated protein kinase phosphatase-1.
22968621 2012 Mammary differentiation induces expression of Tristetraprolin, a tumor suppressor AU-rich mRNA-binding protein.
22960231 2012 AU-rich elements in the 3'-UTR regulate the stability of the 141 amino acid isoform of parathyroid hormone-related protein mRNA.
22918951 2012 Multilevel regulation of HIF-1 signaling by TTP.
22907529 2013 Genetic polymorphisms in RNA binding proteins contribute to breast cancer survival.
22865915 2012 Cutting edge: IL-10-mediated tristetraprolin induction is part of a feedback loop that controls macrophage STAT3 activation and cytokine production.
22863009 2012 Tristetraprolin impairs myc-induced lymphoma and abolishes the malignant state.
22700982 2012 Expression of proviral integration site for Moloney murine leukemia virus 1 (Pim-1) is post-transcriptionally regulated by tristetraprolin in cancer cells.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22544323 2012 ZFP36 expression impairs glioblastoma cell lines viability and invasiveness by targeting multiple signal transduction pathways.
22452791 2012 Identification of tristetraprolin as a factor that modulates the stability of the TAFI transcript through binding to the 3'-untranslated region.
22433566 2012 EGF activates TTP expression by activation of ELK-1 and EGR-1 transcription factors.
22428029 2012 Downregulation of the AU-rich RNA-binding protein ZFP36 in chronic HBV patients: implications for anti-inflammatory therapy.
22426177 2012 HuR post-transcriptionally regulates TNF-?-induced IL-6 expression in human pulmonary microvascular endothelial cells mainly via tristetraprolin.
22387927 2012 Tristetraprolin: roles in cancer and senescence.
22268119 2012 MK2 posttranscriptionally regulates TNF-?-induced expression of ICAM-1 and IL-8 via tristetraprolin in human pulmonary microvascular endothelial cells.
22210895 2012 Ectopic over-expression of tristetraprolin in human cancer cells promotes biogenesis of let-7 by down-regulation of Lin28.
22203679 2012 Direct binding of specific AUF1 isoforms to tandem zinc finger domains of tristetraprolin (TTP) family proteins.
22203041 2012 AU-rich-element-dependent translation repression requires the cooperation of tristetraprolin and RCK/P54.
22138182 2012 Tristetraprolin down-regulates IL-17 through mRNA destabilization.
21964062 2012 Protor-2 interacts with tristetraprolin to regulate mRNA stability during stress.
21875902 2011 A synonymous polymorphism of the Tristetraprolin (TTP) gene, an AU-rich mRNA-binding protein, affects translation efficiency and response to Herceptin treatment in breast cancer patients.
21830391 Tristetraprolin downregulates the expression of both VEGF and COX-2 in human colon cancer.
21818148 2012 The mRNA-binding protein Zfp36 is upregulated by ?-adrenergic stimulation and represses IL-6 production in 3T3-L1 adipocytes.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21775632 2011 Hypoxia-inducible factor-1? mRNA: a new target for destabilization by tristetraprolin in endothelial cells.
21656745 2011 Tristetraprolin regulates interleukin-6, which is correlated with tumor progression in patients with head and neck squamous cell carcinoma.
21611196 2011 miR-346 controls release of TNF-? protein and stability of its mRNA in rheumatoid arthritis via tristetraprolin stabilization.
21606497 2011 Tristetraprolin mediates anti-inflammatory effects of nicotine in lipopolysaccharide-stimulated macrophages.
21593445 2011 Constitutive ERK activity induces downregulation of tristetraprolin, a major protein controlling interleukin8/CXCL8 mRNA stability in melanoma cells.
21507959 2011 Casein kinase 2 regulates the mRNA-destabilizing activity of tristetraprolin.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21278925 The roles of TTP and BRF proteins in regulated mRNA decay.
21078877 2011 Phosphorylation of tristetraprolin by MK2 impairs AU-rich element mRNA decay by preventing deadenylase recruitment.
20828164 2010 Hepatic ?-tocopherol transfer protein: ligand-induced protection from proteasomal degradation.
20702587 2010 ZFP36L1 negatively regulates erythroid differentiation of CD34+ hematopoietic stem cells by interfering with the Stat5b pathway.
20691152 2010 Tristetraprolin controls the stability of cIAP2 mRNA through binding to the 3'UTR of cIAP2 mRNA.
20498646 2010 The RNA-binding zinc-finger protein tristetraprolin regulates AU-rich mRNAs involved in breast cancer-related processes.
20335167 2010 Stability of the LATS2 tumor suppressor gene is regulated by tristetraprolin.
20221403 2010 Phosphorylation of human tristetraprolin in response to its interaction with the Cbl interacting protein CIN85.
20166898 2010 ZFP36L1 is regulated by growth factors and cytokines in keratinocytes and influences their VEGF production.
20157568 2009 The mRNA decay factor tristetraprolin (TTP) induces senescence in human papillomavirus-transformed cervical cancer cells by targeting E6-AP ubiquitin ligase.
20042592 2010 IL-17 regulates CXCL1 mRNA stability via an AUUUA/tristetraprolin-independent sequence.
20038433 2010 Functional switching of TGF-beta1 signaling in liver cancer via epigenetic modulation of a single CpG site in TTP promoter.
19995385 2010 Anthrax lethal toxin promotes dephosphorylation of TTP and formation of processing bodies.
19962963 2010 Tristetraprolin regulates the stability of HIF-1alpha mRNA during prolonged hypoxia.
19697322 2010 Tristetraprolin regulates expression of VEGF and tumorigenesis in human colon cancer.
19654331 2009 Tristetraprolin impairs NF-kappaB/p65 nuclear translocation.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19363120 2009 Tristetraprolin regulates IL-8 mRNA stability in cystic fibrosis lung epithelial cells.
19258311 2009 Tristetraprolin mediates interferon-gamma mRNA decay.
19188452 2009 Stimulation of polo-like kinase 3 mRNA decay by tristetraprolin.
18814951 2008 Gene-expression profiles of peripheral blood mononuclear cell subpopulations in acute graft-vs-host disease following cord blood transplantation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18536977 2008 Tristetraprolin (TTP) gene polymorphisms in patients with rheumatoid arthritis and healthy individuals.
18367721 2008 Identification of TTP mRNA targets in human dendritic cells reveals TTP as a critical regulator of dendritic cell maturation.
18250465 2008 Tristetraprolin regulates CXCL1 (KC) mRNA stability.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17893259 2007 Visceral adipose tissue zinc finger protein 36 mRNA levels are correlated with insulin, insulin resistance index, and adiponectinemia in women.
17855506 2007 Tristetraprolin inhibits Ras-dependent tumor vascularization by inducing vascular endothelial growth factor mRNA degradation.
17606294 2008 Tristetraprolin regulates TNF TNF-alpha mRNA stability via a proteasome dependent mechanism involving the combined action of the ERK and p38 pathways.
17599736 2007 Effects of infliximab therapy on gene expression levels of tumor necrosis factor alpha, tristetraprolin, T cell intracellular antigen 1, and Hu antigen R in patients with rheumatoid arthritis.
17546847 2007 ZFP36: a promising candidate gene for obesity-related metabolic complications identified by converging genomics.
17517366 2007 Comparative expression of tristetraprolin (TTP) family member transcripts in normal human tissues and cancer cell lines.
17369404 2007 TTP and BRF proteins nucleate processing body formation to silence mRNAs with AU-rich elements.
17030620 2006 Novel mRNA targets for tristetraprolin (TTP) identified by global analysis of stabilized transcripts in TTP-deficient fibroblasts.
16935542 2006 Tristetraprolin inhibits HIV-1 production by binding to genomic RNA.
16820934 2006 Expression of TNF-alpha, tristetraprolin, T-cell intracellular antigen-1 and Hu antigen R genes in synovium of patients with rheumatoid arthritis.
16702957 2006 Tristetraprolin regulates Cyclin D1 and c-Myc mRNA stability in response to rapamycin in an Akt-dependent manner via p38 MAPK signaling.
16614304 2006 Atherosclerotic plaque macrophage transcriptional regulators are expressed in blood and modulated by tristetraprolin.
16596264 2006 Gene transduction of tristetraprolin or its active domain reduces TNF-alpha production by Jurkat T cells.
16546352 2006 Genetic variations in ZFP36 and their possible relationship to autoimmune diseases.
16508015 2006 Posttranslational regulation of tristetraprolin subcellular localization and protein stability by p38 mitogen-activated protein kinase and extracellular signal-regulated kinase pathways.
16364915 2005 Multiple processing body factors and the ARE binding protein TTP activate mRNA decapping.
16262601 2006 Identification of the anti-inflammatory protein tristetraprolin as a hyperphosphorylated protein by mass spectrometry and site-directed mutagenesis.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16126846 2005 Involvement of KSRP in the post-transcriptional regulation of human iNOS expression-complex interplay of KSRP with TTP and HuR.
15778452 2005 Tristetraprolin regulates the expression of the human inducible nitric-oxide synthase gene.
15766526 2005 Involvement of microRNA in AU-rich element-mediated mRNA instability.
15687258 2005 Recruitment and activation of mRNA decay enzymes by two ARE-mediated decay activation domains in the proteins TTP and BRF-1.
15634918 2005 Tristetraprolin down-regulates IL-2 gene expression through AU-rich element-mediated mRNA decay.
15535838 2004 The tandem CCCH zinc finger protein tristetraprolin and its relevance to cytokine mRNA turnover and arthritis.
15504035 2004 Expression, purification, and biochemical characterization of the antiinflammatory tristetraprolin: a zinc-dependent mRNA binding protein affected by posttranslational modifications.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280467 2004 Herpes simplex virus 1 induces cytoplasmic accumulation of TIA-1/TIAR and both synthesis and cytoplasmic accumulation of tristetraprolin, two cellular proteins that bind and destabilize AU-rich RNAs.
15231747 2004 A protein interaction framework for human mRNA degradation.
15187101 2004 The role of mRNA turnover in the regulation of tristetraprolin expression: evidence for an extracellular signal-regulated kinase-specific, AU-rich element-dependent, autoregulatory pathway.
15187092 2004 The stability of tristetraprolin mRNA is regulated by mitogen-activated protein kinase p38 and by tristetraprolin itself.
15170914 2004 Expression of tristetraprolin (G0S24) mRNA, a regulator of tumor necrosis factor-alpha production, in synovial tissues of patients with rheumatoid arthritis.
15117938 2004 RNA sequence elements required for high affinity binding by the zinc finger domain of tristetraprolin: conformational changes coupled to the bipartite nature of Au-rich MRNA-destabilizing motifs.
15067324 2004 Gene expression profiling predicts clinical outcome of prostate cancer.
15014438 2004 MK2-induced tristetraprolin:14-3-3 complexes prevent stress granule association and ARE-mRNA decay.
14766228 2004 Direct association of tristetraprolin with the nucleoporin CAN/Nup214.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688255 2004 MAPKAP kinase 2 phosphorylates tristetraprolin on in vivo sites including Ser178, a site required for 14-3-3 binding.
14679154 2003 Interaction of retroviral Tax oncoproteins with tristetraprolin and regulation of tumor necrosis factor-alpha expression.
14604009 2003 Polymorphisms in the genes encoding members of the tristetraprolin family of human tandem CCCH zinc finger proteins.
12823857 2003 Regulation and localization of endogenous human tristetraprolin.
12754205 2003 Transcriptional regulation of tristetraprolin by transforming growth factor-beta in human T cells.
12751757 2003 Tristetraprolin binds to the COX-2 mRNA 3' untranslated region in cancer cells.
12748283 2003 Tristetraprolin and its family members can promote the cell-free deadenylation of AU-rich element-containing mRNAs by poly(A) ribonuclease.
12705825 2003 Selective RNA binding by a single CCCH zinc-binding domain from Nup475 (Tristetraprolin).
12646273 2003 Expression and purification of recombinant tristetraprolin that can bind to tumor necrosis factor-alpha mRNA and serve as a substrate for mitogen-activated protein kinases.
12639954 2003 Characteristics of the interaction of a synthetic human tristetraprolin tandem zinc finger peptide with AU-rich element-containing RNA substrates.
12578839 2003 Tristetraprolin binds to the 3'-untranslated region of cyclooxygenase-2 mRNA. A polyadenylation variant in a cancer cell line lacks the binding site.
12578825 2003 Inherent instability of plasminogen activator inhibitor type 2 mRNA is regulated by tristetraprolin.
12515557 2003 A Cys3His zinc-binding domain from Nup475/tristetraprolin: a novel fold with a disklike structure.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12440952 2002 Tristetraprolin and other CCCH tandem zinc-finger proteins in the regulation of mRNA turnover.
12198173 2002 Functional cloning of BRF1, a regulator of ARE-dependent mRNA turnover.
12115244 2002 Analysis of the function, expression, and subcellular distribution of human tristetraprolin.
11886850 2002 Cytoplasmic localization of tristetraprolin involves 14-3-3-dependent and -independent mechanisms.
11782475 2002 Interactions of CCCH zinc finger proteins with mRNA: non-binding tristetraprolin mutants exert an inhibitory effect on degradation of AU-rich element-containing mRNAs.
11748221 2002 HMGB1 interacts with many apparently unrelated proteins by recognizing short amino acid sequences.
11719186 2001 AU binding proteins recruit the exosome to degrade ARE-containing mRNAs.
11279239 2001 Interactions of CCCH zinc finger proteins with mRNA: tristetraprolin-mediated AU-rich element-dependent mRNA degradation can occur in the absence of a poly(A) tail.
10751406 2000 Interactions of CCCH zinc finger proteins with mRNA. Binding of tristetraprolin-related zinc finger proteins to Au-rich elements and destabilization of mRNA.
10330172 1999 Evidence that tristetraprolin binds to AU-rich elements and promotes the deadenylation and destabilization of tumor necrosis factor alpha mRNA.
9828130 1998 Cloning of ARE-containing genes by AU-motif-directed display.
9703499 1998 Feedback inhibition of macrophage tumor necrosis factor-alpha production by tristetraprolin.
8478004 1993 Chromosomal localization of four human zinc finger cDNAs.
8422274 A human putative lymphocyte G0/G1 switch gene homologous to a rodent gene encoding a zinc-binding potential transcription factor.
7768935 1995 Phosphorylation of tristetraprolin, a potential zinc finger transcription factor, by mitogen stimulation in intact cells and by mitogen-activated protein kinase in vitro.
2204625 1990 Rapid insulin-stimulated accumulation of an mRNA encoding a proline-rich protein.
2062660 1991 The human TTP protein: sequence, alignment with related proteins, and chromosomal localization of the mouse and human genes.
1699942 1990 A growth factor-inducible nuclear protein with a novel cysteine/histidine repetitive sequence.