Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.55
PubTator Score 0.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.426 3.0e-05
astrocytoma 1.100 1.1e-02
atypical teratoid / rhabdoid tumor 1.200 2.5e-05
glioblastoma 1.200 2.2e-05
spina bifida -1.070 2.8e-02

Synonym

Accession Q9H8U3 Q5SZZ0 Q5SZZ1
Symbols TEX27

Gene

PANTHER Protein Class (1)

PDB

1X4W  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLFSEETTSDNNN      1 - 70
TSITTPTLSPSQQPLPTELNVTSPSKEECGPCTDTAHVSLITPTKRSCGTDSQSENEASPVKRPRLLENT     71 - 140
ERSEETSRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGREEAIMKMVK    141 - 210
LDRKVGRSCQRIGEGCS                                                         211 - 227
//

Text Mined References (12)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
22158537 2011 Meta-analysis of genome-wide association studies identifies eight new loci for type 2 diabetes in east Asians.
21901158 2011 Genome-wide detection of allele specific copy number variation associated with insulin resistance in African Americans from the HyperGEN study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10366431 1999 Tex27, a gene containing a zinc-finger domain, is up-regulated during the haploid stages of spermatogenesis.
8703127 1996 Characterization of genes expressed early in mouse spermatogenesis, isolated from a subtractive cDNA library.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.