Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.25
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma -1.200 2.0e-03
atypical teratoid / rhabdoid tumor -1.100 2.4e-05
diabetes mellitus -1.100 1.6e-03
glioblastoma -1.200 4.6e-05
group 4 medulloblastoma -1.100 5.8e-03
Multiple myeloma 1.747 1.4e-03
ovarian cancer -2.000 1.7e-05
subependymal giant cell astrocytoma -1.876 3.7e-02

 GO Function (1)

 Compartment GO Term (2)

AA Sequence

MAELDIGQHCQVEHCRQRDFLPFVCDDCSGIFCLEHRSRESHGCPEVTVINERLKTDQHTSYPCSFKDCA      1 - 70
ERELVAVICPYCEKNFCLRHRHQSDHECEKLEIPKPRMAATQKLVKDIIDSKTGETASKRWKGAKNSETA     71 - 140
AKVALMKLKMHADGDKSLPQTERIYFQVFLPKGSKEKSKPMFFCHRWSIGKAIDFAASLARLKNDNNKFT    141 - 210
AKKLRLCHITSGEALPLDHTLETWIAKEDCPLYNGGNIILEYLNDEEQFCKNVESYLE                211 - 268
//

Text Mined References (11)

PMID Year Title