Property Summary

NCBI Gene PubMed Count 166
PubMed Score 228.80
PubTator Score 273.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Kidney cancer 121 0.0 2.0
Disease Target Count
Mowat-Wilson syndrome 12

Expression

  Differential Expression (37)

Disease log2 FC p
psoriasis -1.800 1.6e-04
osteosarcoma 1.577 2.2e-03
atypical teratoid / rhabdoid tumor -3.200 1.1e-06
medulloblastoma, large-cell -1.700 2.7e-03
primitive neuroectodermal tumor 1.300 1.7e-02
Duchenne muscular dystrophy 1.032 3.6e-07
autosomal dominant Emery-Dreifuss muscul... 1.290 5.4e-04
juvenile dermatomyositis 1.150 6.6e-11
acute quadriplegic myopathy 1.315 1.2e-04
Amyotrophic Lateral Sclerosis 1.198 8.1e-06
adrenocortical carcinoma -2.276 6.3e-07
tuberculosis -1.900 1.7e-04
non-small cell lung cancer -2.030 1.4e-23
intraductal papillary-mucinous adenoma (... -2.000 1.2e-03
intraductal papillary-mucinous carcinoma... -2.500 5.2e-04
intraductal papillary-mucinous neoplasm ... -2.100 1.4e-02
lung cancer -2.700 6.2e-06
sarcoidosis 1.600 2.4e-02
breast carcinoma -1.600 3.1e-04
fibroadenoma -1.800 5.3e-03
interstitial cystitis 1.300 1.2e-04
lung adenocarcinoma -1.500 2.1e-08
pediatric high grade glioma 1.200 8.2e-03
group 4 medulloblastoma 2.100 5.3e-04
pilocytic astrocytoma 1.100 7.1e-03
primary Sjogren syndrome 1.300 2.5e-03
aldosterone-producing adenoma -1.023 2.1e-02
subependymal giant cell astrocytoma 1.158 3.6e-02
invasive ductal carcinoma -2.400 1.1e-04
lung carcinoma -2.400 1.2e-26
Pick disease 1.400 7.2e-05
progressive supranuclear palsy -1.700 1.7e-02
ductal carcinoma in situ -1.600 1.2e-03
ulcerative colitis 1.700 5.7e-04
ovarian cancer -2.600 6.4e-07
Down syndrome 1.200 1.9e-03
head and neck cancer -1.400 1.8e-02

 GO Component (1)

 OMIM Phenotype (1)

Gene RIF (137)

PMID Text
26852091 Report of the first confirmed cases of Mowat Wilson syndrome in three children with the typical facial features, mental retardation, absent corpus callosum, epilepsy, and Hirschsprung's disease and novel Zeb2 variations on DNA analysis.
26823172 suggest that deltaEF1 family proteins promote cell motility of breast cancer cells directly or indirectly through repressing expression of RGS16
26662405 MicroRNA-215 functions as a tumor suppressor and directly targets ZEB2 in human pancreatic cancer
26654950 This is the first study claiming the association of the genetic risks of rs6755392 in the ZEB2 gene with schizophrenia.
26648487 restoration of ZEB2 effectively reversed the Reduced expression of ZEB2, as well as the suppressive effects of miR200b overexpression on the proliferation.
26646296 Bioinformatics analyses showed that miR-138 targeted the 3'-UTR of ZEB2 mRNA to inhibit its translation. Furthermore, miR-138 overexpression inhibited ZEB2-mediated cell invasion and metastases, while miR-138 depletion increased ZEB2-mediated cell invasion and metastases in BC cells
26556542 Our study first indicates that miR-590-3p functions as a suppressor of GBM EMT and metastasis by targeting ZEB1 and ZEB2, and it may be a therapeutic target for metastatic GBM.
26503460 restoration of expression of ZEB2 weakened miR-154-mediated suppression of tumor progression. miR-154 functions as a tumor suppressor in HCC by suppressing ZEB2, suggesting that miR-154 may serve as a potential target for HCC.
26461224 High ZEB2 expression is associated with clear cell kidney carcinoma.
26378039 Results establish that the dowregulation of GADD45G-SIP1 axis may contribute to cellular senescence evasion and HCC development.
26318860 Data indicate zinc finger E-box binding homeobox 2 (ZEB2) as a down-stream target of miR-145 and long non-coding RNA TUG1 exerted its function through the microRNA miR-145/ZEB2 axis.
26220160 Our study demonstrates the role of both ZEB2 and E-cadherin in the promotion of epithelial-mesenchymal transition in eyelid sebaceous gland carcinoma.
26214683 co-expression of TWIST1 and ZEB2 in OSCC was significantly associated with poorer overall survival, particularly in patients without detectable lymph node metastasis.
26193487 This review introduces Zeb2 as an essential regulator of nervous system development.
26136338 nuclear ZEB2 may enhance progression of EMT transition and acquisition of an aggressive phenotype in ovarian cancer
26069251 miRNA network regulates ZEB2 in in colorectal metastasis tissues.
26028330 Genome-wide analysis of the GATA3/G9A/NuRD(MTA3) targets identified a cohort of genes including ZEB2 that are critically involved in epithelial-to-mesenchymal transition and cell invasion.
26022123 miR-139-5p expression is downregulated in hepatocarcinoma tissues and cell lines. miR-139-5p inhibits ZEB1 and ZEB2 expression.
25975736 In gastric tumor samples the expression levels of ZEB2 were inversely correlated with the expression of miR141.
25961171 can inhibit the promoter activity of E-cadherin while enhancing the promoter activity of vimentin
25954928 Based on our results miR-153 inhibits proliferation and suppresses EMT and the invasive potential of ovarian cancer cells through downregulation of SET7 and ZEB2, supporting the pursuit of miR-153 as a potential target for ovarian cancer intervention.
25913622 High expression of SIP1 is associated with gastric cancer.
25894377 we assayed expression of myosin II.. this assay is a powerful predictor of the use of ZEB2/Akt2 as a marker for tumor progression in serous ovarian cancers.
25833697 MiR-139-5p specifically interacts with the 3'-UTR regions of ZEB1 and ZEB2, attenuating their expression in glioblastoma multiforme cells.
25818166 ZEB2 can promote vasculogenic mimicry formation through epithelial-mesenchymal transition in hepatocellular carcinoma.
25797260 Findings reveal that miR-200a suppresses metastasis of SP cells by downregulating ZEB2.
25779673 Study confirmed that FOXA2 inhibited EMT in breast cancer cells by regulating the transcription of EMT-related genes such as E-cadherin and ZEB2.
25762639 This work provides a plausible mechanism for inflammation-induced metastatic potential in TNBC, involving a novel regulatory mechanism governing ZEB2 isoform expression.
25741725 Mosaic deletion of Sip1 in the neocortex reveals defects in axonal growth and in ipsilateral intracortical-collateral formation.
25427583 miR-205 is a candidate tumor suppressor that targets ZEB2 in renal cell carcinoma.
25412653 SIP1 is related to cancer progression and appears to be an independent prognostic factor in pharyngeal squamous cell carcinoma
25301070 Fra-1 induces critical changes in the expression of tgfb1 and Epithelial-to-mesenchymal transition transcription factors through direct binding to the tgfb1, zeb1 and zeb2 genomic regulatory regions.
25296715 These results suggest that the double-negative feedback loop between ZEB2 and miR-145 contributes to prostate cancer progression and metastasis.
25270520 we demonstrate that expression of miRNA-200 family members and ZEB2 are associated with brain metastases of gastric adenocarcinoma, not only in matched patient samples, but also in metastatic cell lines that were derived by in vivo selection.
25052237 miR-200c modulates ovarian cancer cell metastasis potential by targeting ZEB2 expression.
25008569 miR-141 functioned as a tumor suppressor via ZEB2 targeting in hepatocellular carcinoma
24968735 restoration of miR-144 in K1 and WRO thyroid cancer cells suppressed invasion and migration capability of these cells; miR-144 also suppressed expression of ZEB1 and ZEB2, two E-cadherin suppressors, by directly binding to their 3'-untranslated regions.
24914372 miR-132 plays an important role in colorectal cancer invasion and metastasis via directly targeting ZEB2
24885194 Ubiquitin ligase Cbl-b represses IGF-I-induced epithelial mesenchymal transition via ZEB2 and microRNA-200c regulation in gastric cancer cells.
24833103 High Zeb2 expression is associated with mesenchymal tumors.
24829139 ZEB2 was a target of miR-335 action in colorectal cancer metastasis.
24812058 High ZEB2 expression is associated with epithelial-to-mesenchymal transition in prostate cancer.
24810210 The miR-141/ZEB2 axis is involved in epithelial-mesenchymal transition and cancer stem cell regulation by honokiol.
24798342 SIP1 overexpression is associated with hepatocellular carcinoma.
24769353 Overexpression of miR-200b led to the downregulation of ZEB2 at protein level so our results suggested that ZEB2 regulated by miR-200b may contribute to multi-drug resistance of small cell lung cancer.
24715670 The results showed that the 3'-end frameshift mutation of ZEB2 causes MWS due to ZEB2 instability.
24626466 These results indicate that miR-132 suppresses the migration and invasion of NSCLC cells through targeting ZEB2 involving the EMT process
24576558 the single nucleotide polymorphisms in SIP1 gene rs41292293, rs34961586 and rs13017697 are associated with the ectopic expression of this gene in human HSCR and contribute to the susceptibility of this disease in population.
24401652 ZEB2 is a possible candidate gene for primary asplenia.
24306957 ZEB1/ZEB2 and miRNAs expression seems to reliably distinguish between different grades of papillary urothelial tumors of the urinary bladder
24165969 ZEB1 and ZEB2 have been shown to induce epithelial-to-mesenchymal transition.
24130169 High nuclear expression of ZEB2 is associated with colorectal cancer.
24127332 ZEB2 up-regulation is associated with metastatic medullary thyroid carcinoma.
24005989 FoxQ1 promotes hepatocellular carcinoma metastasis by transactivating ZEB2 and VersicanV1 expression.
23933737 In an experimental mouse model for myopia, we observed significant alterations to gene and protein expression in the retina and sclera of the unilateral induced myopic eyes for Zfhx1b and Sntb1.
23813959 Experimental confirmation of miRNA-mRNA interactions established a critical role of miR-200a in regulating both EMT and definitive endoderm formation, through direct repression of ZEB2 and SOX17, during early stage differentiation.
23658743 overexpression (examined by IHC) is an independent biomarker for the poor prognosis of patients with RCC
23479023 Expression of the ZEB2 gene in pancreatic stromal cells in pancreatic ductal adenocarcinoma, pancreatitis, and normal state.
23466526 ZEB2 zinc-finger missense mutations lead to hypomorphic alleles and a mild Mowat-Wilson syndrome.
23427518 The investigation identified a heterozygous complex rearrangement in exon 8 of ZEB2, specifically a 48-nucleotide deletion and a 44-nucleotide insertion that caused a frameshift.
23412770 Vimentin, zeb1 and Sip1 are up-regulated in triple-negative and basal-like breast cancers: association with an aggressive tumour phenotype.
23381389 We found upregulated miR-200a expression to increase E-cadherin and suppress the Wnt/beta-catenin pathway by targeting ZEB1 and ZEB2 in GA, thus delaying tumor growth in vivo.
23376074 these results suggest that E-cadherin expression in cancer cells is controlled by a balance between ZEB2 and KLF4 expression levels.
23352789 The up-regulation in SMAD-interacting protein 1 (SIP1) results in greater repression of the Wnt antagonist, secreted frizzled related protein 1 (Sfrp1) in stem cells.
23312518 Zfhx1b zinc finger homeobox gene is required to generate cortical interneurons in the medial ganglionic eminence.
23312517 Sip1, through tuning of Unc5b levels, is essential for cortical interneuron guidance.
23184150 Genetic variation in ZEB2 influences the risk of renal cell cancer. [Meta-analysis]
23143680 Increased SIP1 expression is associated with peritoneal carcinomatosis in intestinal type gastric cancer.
23052737 It might play an important role in the implantation of metastatic foci.
22949513 Generalized epilepsies implicates susceptibility genes: CHRM3 at 1q43, VRK2 at 2p16.1, ZEB2 at 2q22.3, SCN1A at 2q24.3 and PNPO at 17q21.32.
22892238 levels of ZEB2 expression were low in local lesions but high in metastatic lymph nodes in HNC tissues. Patients with tumors that co-expressed ZEB1(high) and ZEB2(high) had especially poor survival rates.
22761708 Overexpression of ZEB2 is associated with glioma.
22685266 Altered expression of miR-200c may have a significant impact on the outcome of leiomyomas growth, maintenance of their mesenchymal and fibrotic characteristics, and possibly their associated symptoms.
22486326 We report a 9-year-old female with this syndrome who has severe ocular abnormalities including bilateral microphthalmia, cataract, and retinal aplasia.
22414880 We will introduce several genetic approaches, which have been or are currently being applied to the study of PDA, that have been successful in identifying polymorphisms associated with adult diseases.
22393452 of ZEB2 in peritumoral liver tissue correlates with favorable survival after curative resection of hepatocellular carcinoma
22350782 ZEB2 expression is closely associated with the clinicopathological parameters of gastric cancer. ZEB2 promotes gastric cancer cell migration and invasion via the regulation of epithelial-mesenchymal transition.
22311119 zinc finger E-box-binding homeobox 2 (ZEB2) expression is regulated by miR-200b in gastric cancer.
22227038 ZEB2 was found to activate the integrin alpha5 and vimentin promoters by interacting with and activating the transcription factor Sp1, suggesting that cooperation between ZEB2 and Sp1 represents a novel mechanism of mesenchymal gene activation during EMT.
22213144 In primary pancreatic tumors and metastatic lymph nodes, high and low expression of ZEB-1 and ZEB-2 was associated with mesenchymal and epithelial phenotype of cancer cells, respectively.
22103974 Elevated expression of SIP1 can contribute to invasion and metastasis of adenoid cystic carcinoma (ACC), and there might be some correlation between the hypoxia microenvironment and epithelial-mesenchymal transition in ACC.
22042972 Results suggest that ZEB2 may be interesting as biomarker and potential target for treatment of colorectal cancer.
21890822 TGF-beta induced ZEB2, reinforcing its role in epithelial-mesenchymal transition. ZEB2 had some impact upon TGF-beta-induced N-cadherin expression, but not colony formation or miR-205 & miR-220b expression.
21747944 direct binding of TMPRSS2/ERG to the promoter of ZEB1 but not ZEB2
21645397 Epigenetic mechanisms contribute significantly to the downregulation of SIP1 expression in hepatocellular carcinoma
21529905 Results suggest that loss of expression of miR-200a may play a critical role in the repression of E-cadherin by ZEB2, thereby enhancing migration and invasion in CD133/1+ cells.
21518799 p53 regulates epithelial-mesenchymal transition through microRNAs targeting ZEB1 and ZEB2
21426561 These results imply that miR-205 is an ESCC-specific miR that exerts tumor-suppressive activities with epithelial mesenchymal transition inhibition by targeting ZEB2.
21411626 demonstrated the existence of an autocrine TGF-beta/ZEB/miR-200 signaling network that regulates plasticity between epithelial and mesenchymal states.
21079000 These findings implicate the miR-200 family and their targets, ZEB1 and ZEB2, as unique regulators of uterine quiescence and contractility during pregnancy and labor.
20682777 the actions of GH on ZEB2 and P- and E-cadherin expression play a role in the pathogenesis of microalbuminuria of DN.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20585627 Observational study of gene-disease association. (HuGE Navigator)
20551052 Most pancreatic cancers display hypomethylation and overexpression of miR-200a and miR-200b, silencing of SIP1 by promoter methylation, and retention of E-cadherin expression.
20424117 Increased levels of ZEB2 is associated with esophageal neoplasms.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20375168 Knockdown of ZEB2, but not ZEB1, led to Epstein-Barr virus lytic reactivation.
20219685 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20145308 Heterozygous deletion of the ZEB2 gene is associated with Mowat-Wilson syndrome.
20074535 demonstrate that Smad-interacting protein 1 (SIP1) limits the mesendoderm-inducing effects of Activin-Nodal signaling without inhibiting the pluripotency-maintaining effects exerted by SMAD2/3.
19931509 ZEB2 and CTNNB1 are the functional downstream targets of miR-200a and they play distinct roles in regulating nasopharyngeal carcinoma development.
19842203 This report, the first such analysis in North American patients, adds to the growing list of both novel pathogenic mutations associated with Mowat-Wilson syndrome, as well as other variants in the ZEB2 gene.
19706487 The prognostic value of SIP1 and its role in DNA damage response establish a link between genetic instability and metastasis.
19651985 Ladybird homeobox 1 (LBX1), a developmentally regulated homeobox gene, directs expression of the known EMT inducers ZEB1, ZEB2, Snail1, and transforming growth factor beta2 (TGFB2).
19486012 Gene expression profiling of advanced-stage serous ovarian cancers distinguishes novel subclass and implicates ZEB2 in tmor progression and progression.
19336370 Observational study of gene-disease association. (HuGE Navigator)
19215041 Mowat-Wilson syndrome is a genetic condition caused by heterozygous mutations or deletions of the ZEB2 gene.
19183406 In conclusion, Multiplex Ligation-dependent Probe Amplification assessment of rearrangements in the RET proto-oncogene and in 3 other associated genes, ZEB2, EDN3 and GDNF did not show any variants in 80 sporadic Hirschsprung disease patients.
19006215 study describes two sisters with clinical features of Mowat-Wilson syndrome in whom the same nonsense mutation in the ZEB2 gene was found
18829540 A double-negative feedback loop controlling ZEB1-SIP1 and miR-200 family expression.
18411277 loss of expression of the miR-200 family members may play a critical role in the repression of E-cadherin by ZEB1 and ZEB2 during EMT, thereby enhancing migration and invasion during cancer progression.
18376396 Data show that miR-200 and -205 microRNAs cooperatively regulate expression of the E-cadherin transcriptional repressors ZEB1 (also known as deltaEF1) and SIP1 (also known as ZEB2), factors previously implicated in EMT and tumour metastasis.
18259761 Mowat--Wilson syndrome: the clinical report with the novel mutation in ZFHX1B (exon 8: c.2372del C; p.T791fsX816).
18182442 NuRD and Zfhx1b functionally interact, and defective NuRD recruitment by mutant human ZFHX1B can be a Mowat-Wilson syndrome-causing mechanism.
17958891 over 100 deletions/mutations in zinc finger E-box binding protein 2 gene are seen in Mowat-Wilson Syndrome; Clinical features suggest ZEB2 gene activity in development of neural-crest derived cells, central nervous system, heart septation, and midline
17932455 Molecular genetic analysis of ZFHX1B is important for a definite diagnosis of Mowat-Wilson syndrome, which has a wide phenotypic spectrum of congenital anomalies.
17855508 A431 cells expressing SIP1 along with exogenous cyclin D1 were highly invasive
17585049 This study identifies miR-200b as a post-transcriptional regulator of ZFHX1B and demonstrates the ability of miR-200b to affect the promoter activity of the ZFHX1B target gene E-cadherin.
17203459 Over 100 mutations have been described in patients with clinically typical MWS, who almost always have whole gene deletions or truncating mutations (nonsense or frameshift) of ZFHX1B, suggesting that haploinsufficiency is the basis of MWS pathology.
17060462 VHL promotes E2 box-dependent E-cadherin transcription by HIF-mediated regulation of SIP1 and snail
16568083 results therefore implicate SIP1 in the regulation of vimentin observed in the EMT associated with breast tumor cell migration, a pathway that may contribute to the metastatic progression of breast cancer
16532472 A splice mutation causes mental retardation unusually mild for this gene; resulting protein might lack a so far unrecognized putative N-terminal acylation site, which is probably important for neuronal function and facial structures.
16273209 Results suggest that SIP1 contributes to the loss of E-cadherin expression and that detection of SIP1 expression is a predictive and prognostic tool in clinical management of oral carcinomas.
16061479 SIP1 sumoylation by Pc2 attenuates transcriptional repression of E-cadherin
16053902 ZFHX1B deletions, splice site or truncating mutations were detected in all 28 patients classified as typical Mowat-Wilson syndrome.
15742334 Over expression of snail is associated with breast carcinoma aggressiveness
15026811 SIP1 expression may be induced during hepatocellular cell carcinoma progression; SIP1 directly represses E-cad gene transcription and activates cancer invasion via upregulation of the MMP gene family
15006694 ZFHX1B is strongly transcribed at an early stage in the developing peripheral and central nervous systems of both mice and humans, in all neuronal regions of the brains of 25-week human fetuses and adult mice, and in numerous nonneural tissues.
12746390 Review: Mowat-Wilson syndrome is the result of heterozygous deletions or truncating mutations of the ZFHX1B (SIP1) gene on chromosome 2q22
12743039 while ZEB-1/deltaEF1 binds to p300 and promotes the formation of a p300-Smad transcriptional complex, ZEB-2/SIP1 acts as a repressor by recruiting CtBP
12743038 Data show that ZEB-1/deltaEF1 and ZEB-2/SIP1 are regulators of transforming growth factor beta/bone morphogenetic protein signaling, with opposing effects on this pathway.
12175509 SMADIP1 is observed in neural crest derived cells (peripheric nervous system, enteric nervous system, facial neurectoderm and cranial nerve ganglia), central nervous system, genital tubercle, muscles and kidneys in the developing human
12161443 ZEB1 plays a role in repressing E-cadherin and MUC1 in epithelial cells [ZEB-1]
12149685 ZFHX1B may be an important gene for normal embryonic neural crest development. Findings indicate that Hirschsprung's disease can be regarded as a congenital malformation. Mutations were located at exon 8 of ZFHX1B in 3 of 4 cases.
11595972 large-scale deletions and SMADIP1 truncating mutations in syndromic Hirschsprung disease with involvement of midline structures
11592033 nonsense and frameshift mutations in ZFHX1B, encoding Smad-interacting protein 1, cause a complex developmental disorder with a great variety of clinical features
11430829 Conditional expression of SIP1 in E-cadherin-positive cells abrogates E-cadherin-mediated intercellular adhesion and induces invasion. SIP1 therefore appears to be a promoter of invasion in malignant epithelial tumors.

AA Sequence

MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHES      1 - 70
SPHVSQALLPREEEEDEIREGGVEHPWHNNEILQASVDGPEEMKEDYDTMGPEATIQTAINNGTVKNANC     71 - 140
TSDFEEYFAKRKLEERDGHAVSIEEYLQRSDTAIIYPEAPEELSRLGTPEANGQEENDLPPGTPDAFAQL    141 - 210
LTCPYCDRGYKRLTSLKEHIKYRHEKNEENFSCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNR    211 - 280
KFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKT    281 - 350
GSSPNSVSSSPTNSAITQLRNKLENGKPLSMSEQTGLLKIKTEPLDFNDYKVLMATHGFSGTSPFMNGGL    351 - 420
GATSPLGVHPSAQSPMQHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKAEEISKLKGYH    421 - 490
MKDPCSQPEEQGVTSPNIPPVGLPVVSHNGATKSIIDYTLEKVNEAKACLQSLTTDSRRQISNIKKEKLR    491 - 560
TLIDLVTDDKMIENHNISTPFSCQFCKESFPGPIPLHQHERYLCKMNEEIKAVLQPHENIVPNKAGVFVD    561 - 630
NKALLLSSVLSEKGMTSPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQY    631 - 700
SNSRSPSLERSSKPLAPNSNPPTKDSLLPRSPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIK    701 - 770
PVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKAS    771 - 840
SISLDHNSVSSSSENSDEPLNLTFIKKEFSNSNNLDNKSTNPVFSMNPFSAKPLYTALPPQSAFPPATFM    841 - 910
PPVQTSIPGLRPYPGLDQMSFLPHMAYTYPTGAATFADMQQRRKYQRKQGFQGELLDGAQDYMSGLDDMT    911 - 980
DSDSCLSRKKIKKTESGMYACDLCDKTFQKSSSLLRHKYEHTGKRPHQCQICKKAFKHKHHLIEHSRLHS    981 - 1050
GEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEEREAAEREAREKGHLEPTELLMNRAYLQSITPQG   1051 - 1120
YSDSEERESMPRDGESEKEHEKEGEDGYGKLGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSM   1121 - 1190
DDSSEDGKMETKSDHEEDNMEDGM                                                 1191 - 1214
//

Text Mined References (172)

PMID Year Title
26852091 2016 Novel Zeb2 gene variation in the Mowat Wilson syndrome (MWS).
26823172 2016 The potential role of regulator of G-protein signaling 16 in cell motility mediated by ?EF1 family proteins.
26662405 2015 MicroRNA-215 functions as a tumor suppressor and directly targets ZEB2 in human pancreatic cancer.
26654950 2016 A new risk locus in the ZEB2 gene for schizophrenia in the Han Chinese population.
26648487 2016 MicroRNA-200b inhibits the growth and metastasis of glioma cells via targeting ZEB2.
26646296 2015 MicroRNA-138 Regulates Metastatic Potential of Bladder Cancer Through ZEB2.
26556542 2015 miR-590-3p suppresses cancer cell migration, invasion and epithelial-mesenchymal transition in glioblastoma multiforme by targeting ZEB1 and ZEB2.
26503460 2015 miR-154 targeting ZEB2 in hepatocellular carcinoma functions as a potential tumor suppressor.
26461224 2015 LncRNA MALAT1 functions as a competing endogenous RNA to regulate ZEB2 expression by sponging miR-200s in clear cell kidney carcinoma.
26378039 2015 SIP1 is a downstream effector of GADD45G in senescence induction and growth inhibition of liver tumor cells.
26318860 2015 Double-negative feedback loop between long non-coding RNA TUG1 and miR-145 promotes epithelial to mesenchymal transition and radioresistance in human bladder cancer cells.
26220160 2015 ZEB2/SIP1 as novel prognostic indicator in eyelid sebaceous gland carcinoma.
26214683 2015 Co-Expression of TWIST1 and ZEB2 in Oral Squamous Cell Carcinoma Is Associated with Poor Survival.
26193487 2015 Zeb2: A multifunctional regulator of nervous system development.
26136338 2015 Role and prognostic significance of the epithelial-mesenchymal transition factor ZEB2 in ovarian cancer.
26069251 2015 A Systematic Approach to Defining the microRNA Landscape in Metastasis.
26028330 2015 Dysfunction of the Reciprocal Feedback Loop between GATA3- and ZEB2-Nucleated Repression Programs Contributes to Breast Cancer Metastasis.
26022123 2015 miR-139-5p inhibits epithelial-mesenchymal transition, migration and invasion of hepatocellular carcinoma cells by targeting ZEB1 and ZEB2.
25975736 2015 MicroRNA-141 inhibits migration of gastric cancer by targeting zinc finger E-box-binding homeobox 2.
25961171 2015 MicroRNA-129-5p modulates epithelial-to-mesenchymal transition by targeting SIP1 and SOX4 during peritoneal dialysis.
25954928 2015 MicroRNA-153 functions as a tumor suppressor by targeting SET7 and ZEB2 in ovarian cancer cells.
25913622 2015 Expression of SIP1 is strongly correlated with LDHA and shows a significantly poor outcome in gastric cancer.
25894377 2015 Akt2/ZEB2 may be a biomarker for exfoliant cells in ascitic fluid in advanced grades of serous ovarian carcinoma.
25833697 2015 miR-139-5p suppresses cancer cell migration and invasion through targeting ZEB1 and ZEB2 in GBM.
25818166 2015 ZEB2 promotes vasculogenic mimicry by TGF-?1 induced epithelial-to-mesenchymal transition in hepatocellular carcinoma.
25797260 2015 MicroRNA-200a suppresses metastatic potential of side population cells in human hepatocellular carcinoma by decreasing ZEB2.
25779673 2015 FOXA2 attenuates the epithelial to mesenchymal transition by regulating the transcription of E-cadherin and ZEB2 in human breast cancer.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25762639 2015 AP-1-mediated chromatin looping regulates ZEB2 transcription: new insights into TNF?-induced epithelial-mesenchymal transition in triple-negative breast cancer.
25741725 2015 Sip1 downstream Effector ninein controls neocortical axonal growth, ipsilateral branching, and microtubule growth and stability.
25427583 2014 miRNA-205 is a candidate tumor suppressor that targets ZEB2 in renal cell carcinoma.
25412653 2015 SIP1 predicts progression and poor prognosis in pharyngeal squamous cell carcinoma.
25301070 2015 Fra-1/AP-1 induces EMT in mammary epithelial cells by modulating Zeb1/2 and TGF? expression.
25296715 2014 Double-negative feedback loop between ZEB2 and miR-145 regulates epithelial-mesenchymal transition and stem cell properties in prostate cancer cells.
25270520 2014 MicroRNA-200 family members and ZEB2 are associated with brain metastasis in gastric adenocarcinoma.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25052237 2014 miR-200c modulates ovarian cancer cell metastasis potential by targeting zinc finger E-box-binding homeobox 2 (ZEB2) expression.
25008569 2014 MiR-141 targets ZEB2 to suppress HCC progression.
24968735 2015 Down-regulation of miR-144 promotes thyroid cancer cell invasion by targeting ZEB1 and ZEB2.
24914372 2014 miR-132 inhibits colorectal cancer invasion and metastasis via directly targeting ZEB2.
24885194 2014 Ubiquitin ligase Cbl-b represses IGF-I-induced epithelial mesenchymal transition via ZEB2 and microRNA-200c regulation in gastric cancer cells.
24833103 2014 Epithelial to mesenchymal transition is associated with shorter disease-free survival in hepatocellular carcinoma.
24829139 2014 MicroRNA-335 inhibits invasion and metastasis of colorectal cancer by targeting ZEB2.
24812058 2014 Androgen receptor as a regulator of ZEB2 expression and its implications in epithelial-to-mesenchymal transition in prostate cancer.
24810210 2014 Honokiol suppresses renal cancer cells' metastasis via dual-blocking epithelial-mesenchymal transition and cancer stem cell properties through modulating miR-141/ZEB2 signaling.
24798342 2014 microRNA-148a dysregulation discriminates poor prognosis of hepatocellular carcinoma in association with USP4 overexpression.
24769727 2014 Identification of a ZEB2-MITF-ZEB1 transcriptional network that controls melanogenesis and melanoma progression.
24769353 2014 Zinc finger E-box-binding homeobox 2 (ZEB2) regulated by miR-200b contributes to multi-drug resistance of small cell lung cancer.
24715670 2014 The spectrum of ZEB2 mutations causing the Mowat-Wilson syndrome in Japanese populations.
24626466 2014 MiR-132 suppresses the migration and invasion of lung cancer cells via targeting the EMT regulator ZEB2.
24576558 2014 The single nucleotide polymorphisms in Smad-interacting protein 1 gene contribute to its ectopic expression and susceptibility in Hirschsprung's disease.
24401652 2014 ZEB2, a new candidate gene for asplenia.
24306957 2014 Expression of miRNAs and ZEB1 and ZEB2 correlates with histopathological grade in papillary urothelial tumors of the urinary bladder.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24165969 2014 Langerhans cell maturation is accompanied by induction of N-cadherin and the transcriptional regulators of epithelial-mesenchymal transition ZEB1/2.
24130169 2014 ZEB2-Sp1 cooperation induces invasion by upregulating cadherin-11 and integrin ?5 expression.
24127332 2013 A miRNA signature associated with human metastatic medullary thyroid carcinoma.
24005989 2014 Forkhead box Q1 promotes hepatocellular carcinoma metastasis by transactivating ZEB2 and VersicanV1 expression.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23933737 2013 Genome-wide association study identifies ZFHX1B as a susceptibility locus for severe myopia.
23813959 2013 Matched miRNA and mRNA signatures from an hESC-based in vitro model of pancreatic differentiation reveal novel regulatory interactions.
23658743 2013 Protein expression of ZEB2 in renal cell carcinoma and its prognostic significance in patient survival.
23479023 2013 Expression of the ZEB2 gene in pancreatic stromal cells in pancreatic ductal adenocarcinoma, pancreatitis, and normal state.
23466526 2013 ZEB2 zinc-finger missense mutations lead to hypomorphic alleles and a mild Mowat-Wilson syndrome.
23427518 A case of Mowat-Wilson syndrome caused by a truncating mutation within exon 8 of the ZEB2 gene.
23412770 2013 Vimentin, zeb1 and Sip1 are up-regulated in triple-negative and basal-like breast cancers: association with an aggressive tumour phenotype.
23381389 2013 Downregulated microRNA-200a promotes EMT and tumor growth through the wnt/?-catenin pathway by targeting the E-cadherin repressors ZEB1/ZEB2 in gastric adenocarcinoma.
23376074 2013 Interplay between KLF4 and ZEB2/SIP1 in the regulation of E-cadherin expression.
23352789 2013 BMP and TGF-? pathway mediators are critical upstream regulators of Wnt signaling during midbrain dopamine differentiation in human pluripotent stem cells.
23312518 2013 Dlx1&2-dependent expression of Zfhx1b (Sip1, Zeb2) regulates the fate switch between cortical and striatal interneurons.
23312517 2013 Directed migration of cortical interneurons depends on the cell-autonomous action of Sip1.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184150 2013 Common variation at 2q22.3 (ZEB2) influences the risk of renal cancer.
23143680 2013 Smad interacting protein 1 (SIP1) is associated with peritoneal carcinomatosis in intestinal type gastric cancer.
23052737 2013 Differences in the expression of epithelial-mesenchymal transition related molecules between primary tumors and pulmonary metastatic tumors in colorectal cancer.
22949513 2012 Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32.
22892238 2013 Epithelial-mesenchymal transition transcription factor ZEB1/ZEB2 co-expression predicts poor prognosis and maintains tumor-initiating properties in head and neck cancer.
22761708 2012 ZEB2 mediates multiple pathways regulating cell proliferation, migration, invasion, and apoptosis in glioma.
22685266 2012 miR-200c is aberrantly expressed in leiomyomas in an ethnic-dependent manner and targets ZEBs, VEGFA, TIMP2, and FBLN5.
22486326 2012 Ophthalmologic abnormalities in Mowat-Wilson syndrome and a mutation in ZEB2.
22414880 2012 Genetics of patent ductus arteriosus susceptibility and treatment.
22393452 2012 Overexpression of ZEB2 in peritumoral liver tissue correlates with favorable survival after curative resection of hepatocellular carcinoma.
22350782 2012 ZEB2 promotes the metastasis of gastric cancer and modulates epithelial mesenchymal transition of gastric cancer cells.
22311119 2012 MicroRNA-200b regulates cell proliferation, invasion, and migration by directly targeting ZEB2 in gastric carcinoma.
22227038 2012 ZEB2 upregulates integrin ?5 expression through cooperation with Sp1 to induce invasion during epithelial-mesenchymal transition of human cancer cells.
22213144 2012 Epithelial-mesenchymal transition and mesenchymal-epithelial transition via regulation of ZEB-1 and ZEB-2 expression in pancreatic cancer.
22103974 2012 Coexpression of hypoxia-inducible factor-2?, TWIST2, and SIP1 may correlate with invasion and metastasis of salivary adenoid cystic carcinoma.
22042972 2011 Overexpression of ZEB2 at the invasion front of colorectal cancer is an independent prognostic marker and regulates tumor invasion in vitro.
21890822 2011 A NOTCH3-mediated squamous cell differentiation program limits expansion of EMT-competent cells that express the ZEB transcription factors.
21747944 2011 TMPRSS2/ERG promotes epithelial to mesenchymal transition through the ZEB1/ZEB2 axis in a prostate cancer model.
21645397 2011 SIP1 is downregulated in hepatocellular carcinoma by promoter hypermethylation.
21529905 2011 MicroRNA-200a inhibits CD133/1+ ovarian cancer stem cells migration and invasion by targeting E-cadherin repressor ZEB2.
21518799 2011 p53 regulates epithelial-mesenchymal transition through microRNAs targeting ZEB1 and ZEB2.
21426561 2011 MiRNA-205 modulates cellular invasion and migration via regulating zinc finger E-box binding homeobox 2 expression in esophageal squamous cell carcinoma cells.
21411626 2011 An autocrine TGF-beta/ZEB/miR-200 signaling network regulates establishment and maintenance of epithelial-mesenchymal transition.
21079000 2010 miR-200 family and targets, ZEB1 and ZEB2, modulate uterine quiescence and contractility during pregnancy and labor.
20682777 2010 Growth hormone (GH)-dependent expression of a natural antisense transcript induces zinc finger E-box-binding homeobox 2 (ZEB2) in the glomerular podocyte: a novel action of gh with implications for the pathogenesis of diabetic nephropathy.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20585627 2010 Web-based, participant-driven studies yield novel genetic associations for common traits.
20551052 2010 Pancreatic cancers epigenetically silence SIP1 and hypomethylate and overexpress miR-200a/200b in association with elevated circulating miR-200a and miR-200b levels.
20516212 2010 Regulation of the expression and activity of the antiangiogenic homeobox gene GAX/MEOX2 by ZEB2 and microRNA-221.
20515682 2010 Novel monoclonal antibodies detect Smad-interacting protein 1 (SIP1) in the cytoplasm of human cells from multiple tumor tissue arrays.
20424117 2010 Epidermal growth factor receptor and mutant p53 expand an esophageal cellular subpopulation capable of epithelial-to-mesenchymal transition through ZEB transcription factors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20375168 2010 Either ZEB1 or ZEB2/SIP1 can play a central role in regulating the Epstein-Barr virus latent-lytic switch in a cell-type-specific manner.
20219685 2010 Pathway-based approaches to imaging genetics association studies: Wnt signaling, GSK3beta substrates and major depression.
20145308 2010 Severe clinical course of Hirschsprung disease in a Mowat-Wilson syndrome patient.
20074535 2010 SIP1 mediates cell-fate decisions between neuroectoderm and mesendoderm in human pluripotent stem cells.
19931509 2010 miR-200a-mediated downregulation of ZEB2 and CTNNB1 differentially inhibits nasopharyngeal carcinoma cell growth, migration and invasion.
19842203 2009 Comprehensive ZEB2 gene analysis for Mowat-Wilson syndrome in a North American cohort: a suggested approach to molecular diagnostics.
19830559 2010 MicroRNA-141 regulates Smad interacting protein 1 (SIP1) and inhibits migration and invasion of colorectal cancer cells.
19706487 2009 SIP1 protein protects cells from DNA damage-induced apoptosis and has independent prognostic value in bladder cancer.
19651985 2009 A developmentally regulated inducer of EMT, LBX1, contributes to breast cancer progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19486012 2009 Gene expression profiling of advanced-stage serous ovarian cancers distinguishes novel subclasses and implicates ZEB2 in tumor progression and prognosis.
19381684 2009 Transcription factors Snail, Slug, Twist, and SIP1 in spindle cell carcinoma of the head and neck.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19215041 2009 Mowat-Wilson syndrome: facial phenotype changing with age: study of 19 Italian patients and review of the literature.
19183406 2009 Analysis of RET, ZEB2, EDN3 and GDNF genomic rearrangements in 80 patients with Hirschsprung disease (using multiplex ligation-dependent probe amplification).
19006215 2008 Recurrence of Mowat-Wilson syndrome in siblings with a novel mutation in the ZEB2 gene.
18829540 2008 A double-negative feedback loop between ZEB1-SIP1 and the microRNA-200 family regulates epithelial-mesenchymal transition.
18411277 2008 The miR-200 family inhibits epithelial-mesenchymal transition and cancer cell migration by direct targeting of E-cadherin transcriptional repressors ZEB1 and ZEB2.
18376396 2008 The miR-200 family and miR-205 regulate epithelial to mesenchymal transition by targeting ZEB1 and SIP1.
18259761 2008 Mowat--Wilson syndrome: the clinical report with the novel mutation in ZFHX1B (exon 8: c.2372del C; p.T791fsX816).
18182442 2008 Atypical Mowat-Wilson patient confirms the importance of the novel association between ZFHX1B/SIP1 and NuRD corepressor complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17958891 2007 Mowat-Wilson syndrome.
17932455 2007 Nonsense mutations of the ZFHX1B gene in two Japanese girls with Mowat-Wilson syndrome.
17855508 2007 Direct repression of cyclin D1 by SIP1 attenuates cell cycle progression in cells undergoing an epithelial mesenchymal transition.
17585049 2007 miR-200b mediates post-transcriptional repression of ZFHX1B.
17360662 2007 MicroRNA-192 in diabetic kidney glomeruli and its function in TGF-beta-induced collagen expression via inhibition of E-box repressors.
17203459 2007 ZFHX1B mutations in patients with Mowat-Wilson syndrome.
17060462 2007 VHL promotes E2 box-dependent E-cadherin transcription by HIF-mediated regulation of SIP1 and snail.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16688751 2006 A missense mutation in the ZFHX1B gene associated with an atypical Mowat-Wilson syndrome phenotype.
16568083 2006 Regulation of vimentin by SIP1 in human epithelial breast tumor cells.
16532472 2006 Atypical ZFHX1B mutation associated with a mild Mowat-Wilson syndrome phenotype.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273209 2005 Expression of SIP1 in oral squamous cell carcinomas: implications for E-cadherin expression and tumor progression.
16061479 2005 Pc2-mediated sumoylation of Smad-interacting protein 1 attenuates transcriptional repression of E-cadherin.
16053902 Clinical and mutational spectrum of Mowat-Wilson syndrome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15742334 2005 Snail, Slug, and Smad-interacting protein 1 as novel parameters of disease aggressiveness in metastatic ovarian and breast carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15384097 2004 Ocular coloboma and high myopia with Hirschsprung disease associated with a novel ZFHX1B missense mutation and trisomy 21.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15121779 2004 Clinical and molecular analysis of Mowat-Wilson syndrome associated with ZFHX1B mutations and deletions at 2q22-q24.1.
15026811 2004 Snail and SIP1 increase cancer invasion by upregulating MMP family in hepatocellular carcinoma cells.
15006694 2004 Pleiotropic and diverse expression of ZFHX1B gene transcripts during mouse and human development supports the various clinical manifestations of the "Mowat-Wilson" syndrome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12920073 2003 Characterisation of deletions of the ZFHX1B region and genotype-phenotype analysis in Mowat-Wilson syndrome.
12837246 2003 Multiple tumor suppressor pathways negatively regulate telomerase.
12746390 2003 Mowat-Wilson syndrome.
12743039 2003 Regulation of Smad signaling through a differential recruitment of coactivators and corepressors by ZEB proteins.
12743038 2003 Opposing functions of ZEB proteins in the regulation of the TGFbeta/BMP signaling pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12451214 2002 Late infantile Hirschsprung disease-mental retardation syndrome with a 3-bp deletion in ZFHX1B.
12175509 2002 Expression of the SMADIP1 gene during early human development.
12161443 2002 Snail induction of epithelial to mesenchymal transition in tumor cells is accompanied by MUC1 repression and ZEB1 expression.
12149685 2002 Clinical features of a form of Hirschsprung's disease caused by a novel genetic abnormality.
11891681 2002 "Mowat-Wilson" syndrome with and without Hirschsprung disease is a distinct, recognizable multiple congenital anomalies-mental retardation syndrome caused by mutations in the zinc finger homeo box 1B gene.
11592033 2001 Nonsense and frameshift mutations in ZFHX1B, encoding Smad-interacting protein 1, cause a complex developmental disorder with a great variety of clinical features.
11477103 2001 Smad-interacting protein 1 is a repressor of liver/bone/kidney alkaline phosphatase transcription in bone morphogenetic protein-induced osteogenic differentiation of C2C12 cells.
11448942 2001 Loss-of-function mutations in SIP1 Smad interacting protein 1 result in a syndromic Hirschsprung disease.
11430829 2001 The two-handed E box binding zinc finger protein SIP1 downregulates E-cadherin and induces invasion.
11279515 2001 Mutations in SIP1, encoding Smad interacting protein-1, cause a form of Hirschsprung disease.
10400677 1999 SIP1, a novel zinc finger/homeodomain repressor, interacts with Smad proteins and binds to 5'-CACCT sequences in candidate target genes.
9853615 1998 Selection system for genes encoding nuclear-targeted proteins.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.