Property Summary

NCBI Gene PubMed Count 27
PubMed Score 18.83
PubTator Score 23.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 2.001 1.9e-07
ependymoma -1.100 7.8e-12
glioblastoma -1.400 8.4e-07
medulloblastoma -1.400 1.4e-07
atypical teratoid / rhabdoid tumor -1.500 1.0e-10
medulloblastoma, large-cell -1.500 1.2e-04
primitive neuroectodermal tumor -1.500 2.6e-05
tuberculosis 1.100 5.0e-07
pediatric high grade glioma -1.200 3.1e-07
pilocytic astrocytoma -1.100 2.0e-07

Gene RIF (20)

PMID Text
23403413 These data suggest that ZDHHC8 may play a role in cortical volumes in patients with schizophrenia.
22763378 increased corpus callosum volume in children with 22q11DS is associated with ZDHHC8 polymorphism.
20661937 Consistently negative associations with schizophrenia were found in the rs175174 polymorphism
20661937 Meta-analysis of gene-disease association. (HuGE Navigator)
20468065 The present study provides the first evidence that ZDHHC8 polymorphisms on the 22q11 locus are associated with smooth pursuit eye movement (SPEM)abnormality in a Korean population.
20468065 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
19801377 Data show that palmitoyl acyltransferases DHHC5, DHHC6, and DHHC8 appear to be S-acylated on three cysteine residues within a novel CCX(7-13)C(S/T) motif downstream of a conserved Asp-His-His-Cys cysteine-rich domain.
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18075473 Observational study of gene-disease association. (HuGE Navigator)
17728672 Single nucleotide polymorphism is not associated with chromosome 22 deletion or schizophrenia.
16860541 Observational study of gene-disease association. (HuGE Navigator)
16225675 Observational study of gene-disease association. (HuGE Navigator)
16150541 Observational study of gene-disease association. (HuGE Navigator)
15992527 Observational study of gene-disease association. (HuGE Navigator)
15631889 Observational study of gene-disease association. (HuGE Navigator)
15631889 Because our sample size provided quite high power, ZDHHC8 may not play a major role in Japanese schizophrenia and our results did not support the gender-specific effect of this SNP.
15489219 Observational study of gene-disease association. (HuGE Navigator)
15489219 genotyped three genetic variants within the ZDHHC8 locus and conducted association studies in both population- and family-based samples of the Han Chinese population

AA Sequence

MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLANFSMATFMDP      1 - 70
GVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNC     71 - 140
IGRRNYRYFFLFLLSLSAHMVGVVAFGLVYVLNHAEGLGAAHTTITMAVMCVAGLFFIPVIGLTGFHVVL    141 - 210
VTRGRTTNEQVTGKFRGGVNPFTRGCCGNVEHVLCSPLAPRYVVEPPRLPLAVSLKPPFLRPELLDRAAP    211 - 280
LKVKLSDNGLKAGLGRSKSKGSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPP    281 - 350
TPAMYKFRPAFPTGPKVPFCGPGEQVPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPL    351 - 420
SASDAFSGALRSLSLKASSRRGGDHVALQPLRSEGGPPTPHRSIFAPHALPNRNGSLSYDSLLNPGSPGG    421 - 490
HACPAHPAVGVAGYHSPYLHPGATGDPPRPLPRSFSPVLGPRPREPSPVRYDNLSRTIMASIQERKDREE    491 - 560
RERLLRSQADSLFGDSGVYDAPSSYSLQQASVLSEGPRGPALRYGSRDDLVAGPGFGGARNPALQTSLSS    561 - 630
LSSSVSRAPRTSSSSLQADQASSNAPGPRPSSGSHRSPARQGLPSPPGTPHSPSYAGPKAVAFIHTDLPE    631 - 700
PPPSLTVQRDHPQLKTPPSKLNGQSPGLARLGPATGPPGPSASPTRHTLVKKVSGVGGTTYEISV         701 - 765
//

Text Mined References (30)

PMID Year Title
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
23403413 2013 ZDHHC8 gene may play a role in cortical volumes of patients with schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22763378 2012 Increased corpus callosum volume in children with chromosome 22q11.2 deletion syndrome is associated with neurocognitive deficits and genetic polymorphisms.
20661937 2010 Testing for genetic association between the ZDHHC8 gene locus and susceptibility to schizophrenia: An integrated analysis of multiple datasets.
20468065 2010 Association of ZDHHC8 polymorphisms with smooth pursuit eye movement abnormality.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19801377 2010 Proteome scale characterization of human S-acylated proteins in lipid raft-enriched and non-raft membranes.
19556522 2009 Palmitoylation of ATP-binding cassette transporter A1 is essential for its trafficking and function.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
18075473 2007 HTF9C gene of 22q11.21 region associates with schizophrenia having deficit-sustained attention.
17728672 2007 ZDHHC8 single nucleotide polymorphism rs175174 is not associated with psychiatric features of the 22q11 deletion syndrome or schizophrenia.
16860541 2006 Analysis of ProDH, COMT and ZDHHC8 risk variants does not support individual or interactive effects on schizophrenia susceptibility.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
16225675 2005 ZDHHC8 as a candidate gene for schizophrenia: analysis of a putative functional intronic marker in case-control and family-based association studies.
16150541 2005 The ZDHHC8 gene did not associate with bipolar disorder or schizophrenia.
15992527 2005 No association between the putative functional ZDHHC8 single nucleotide polymorphism rs175174 and schizophrenia in large European samples.
15631889 2005 No association was found between a functional SNP in ZDHHC8 and schizophrenia in a Japanese case-control population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15489219 2004 Case-control study and transmission disequilibrium test provide consistent evidence for association between schizophrenia and genetic variation in the 22q11 gene ZDHHC8.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15184899 2004 Evidence that the gene encoding ZDHHC8 contributes to the risk of schizophrenia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.