Property Summary

NCBI Gene PubMed Count 16
PubMed Score 69.12
PubTator Score 37.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
urothelial carcinoma -2.400 3.4e-03
osteosarcoma -2.561 1.5e-04
group 4 medulloblastoma -2.100 1.3e-04
fascioscapulohumeral muscular dystrophy 1.020 9.0e-05
adrenocortical carcinoma -1.733 8.0e-03
tuberculosis 1.300 1.5e-05
non-small cell lung cancer -1.227 3.1e-11
intraductal papillary-mucinous neoplasm ... -1.600 5.5e-03
interstitial cystitis -1.500 6.4e-05
lung carcinoma 1.100 7.5e-22
spina bifida 1.035 4.5e-02
Breast cancer -2.900 7.3e-11
invasive ductal carcinoma -1.300 1.9e-02
ovarian cancer -2.500 1.2e-05

Gene RIF (9)

PMID Text
24995331 These results suggest an important role for ZDHHC2 as a tumor suppressor in metastasis and recurrence of HCC.
23457560 reduced ZDHHC2 expression is associated with lymph node metastasis and independently predicts an unfavorable prognosis in gastric adenocarcinoma patients
22034844 DHHC2 localizes primarily to the endoplasmic reticulum and Golgi apparatus suggesting that it is involved in S-acylation of newly-synthesized or recycling Lck involved in T cell signalling.
21471008 The palmitoyl transferase DHHC2 targets a dynamic membrane cycling pathway: regulation by a C-terminal domain
21343290 Gi/o signaling and the palmitoyltransferase DHHC2 regulate palmitate cycling and shuttling of RGS7 family-binding protein.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19144824 DHHC2-mediated palmitoylation of CKAP4 has a role in opposing cancer-related cellular behaviors.
18508921 DHHC2 affects palmitoylation, stability, and functions of tetraspanins CD9 and CD151
18296695 Identification of CKAP4/p63 as a substrate of DHHC2, a putative tumor suppressor.

AA Sequence

MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYHLLFAMFVWSY      1 - 70
WKTIFTLPMNPSKEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLIKPDRC     71 - 140
HHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQYFIKFWTNGLPDTQAKFH    141 - 210
IMFLFFAAAMFSVSLSSLFGYHCWLVSKNKSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWL    211 - 280
LPIFSSLGDGCSFPTCLVNQDPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINPG    281 - 350
KCKAGMSNPALTMENET                                                         351 - 367
//

Text Mined References (17)

PMID Year Title
24995331 2014 A critical role for ZDHHC2 in metastasis and recurrence in human hepatocellular carcinoma.
23457560 2013 Reduced expression of ZDHHC2 is associated with lymph node metastasis and poor prognosis in gastric adenocarcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22034844 DHHC2 is a protein S-acyltransferase for Lck.
21471008 2011 The palmitoyl transferase DHHC2 targets a dynamic membrane cycling pathway: regulation by a C-terminal domain.
21343290 2011 Gi/o signaling and the palmitoyltransferase DHHC2 regulate palmitate cycling and shuttling of RGS7 family-binding protein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19144824 2009 Palmitoylation of cytoskeleton associated protein 4 by DHHC2 regulates antiproliferative factor-mediated signaling.
18508921 2008 DHHC2 affects palmitoylation, stability, and functions of tetraspanins CD9 and CD151.
18296695 2008 Identification of CKAP4/p63 as a major substrate of the palmitoyl acyltransferase DHHC2, a putative tumor suppressor, using a novel proteomics method.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12021275 2002 Aph2, a protein with a zf-DHHC motif, interacts with c-Abl and has pro-apoptotic activity.
10918388 2000 Isolation of a novel gene on 8p21.3-22 whose expression is reduced significantly in human colorectal cancers with liver metastasis.