Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.97
PubTator Score 2.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.8e-06
Disease Target Count Z-score Confidence
Morphine dependence 16 4.367 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.800 4.8e-06

Gene RIF (2)

AA Sequence

MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRA      1 - 70
INNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSKCYECGESGHLSYACPKNMLGEREPPKKKEKKKKK     71 - 140
KAPEPEEEIEEVEESEDEGEDPALDSLSQAIAFQQAKIEEEQKKWKPSSGVPSTSDDSRRPRIKKSTYFS    141 - 210
DEEELSD                                                                   211 - 217
//

Text Mined References (14)

PMID Year Title