Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.71
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.7e-04
ovarian cancer 8491 5.5e-03

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.7e-04
ovarian cancer 1.200 5.5e-03

AA Sequence

MTRWARVSTTYNKRPLPATSWEDMKKGSFEGTSQNLPKRKQLEANRLSLKNDAPQAKHKKNKKKKEYLNE      1 - 70
DVNGFMEYLRQNSQMVHNGQIIATDSEEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRKPGHGI     71 - 140
ADCPAALENQDMGTGICYRCGSTEHEITKCKAKVDPALGEFPFAKCFVCGEMGHLSRSCPDNPKGLYADG    141 - 210
GGCKLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYEEILDVPKPQKPKTKIPKVVNF             211 - 271
//

Text Mined References (11)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
18721783 2008 A nuclear localized protein ZCCHC9 is expressed in cerebral cortex and suppresses the MAPK signal pathway.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.