Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.30
PubTator Score 0.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
oligodendroglioma 1.600 2.6e-02
psoriasis -1.300 2.5e-04
osteosarcoma 3.121 7.5e-05
group 3 medulloblastoma -3.300 7.4e-06
atypical teratoid/rhabdoid tumor -3.000 1.1e-10
medulloblastoma, large-cell -3.000 5.7e-06
primitive neuroectodermal tumor -1.400 4.9e-02
adrenocortical carcinoma -1.009 4.6e-04
primary pancreatic ductal adenocarcinoma 1.803 1.3e-04
intraductal papillary-mucinous adenoma (... -1.500 9.5e-03
intraductal papillary-mucinous carcinoma... -2.200 1.2e-03
intraductal papillary-mucinous neoplasm ... -2.400 6.5e-03
lung cancer -1.800 4.6e-04
colon cancer -1.800 6.4e-04
pilocytic astrocytoma 1.800 1.0e-06
lung adenocarcinoma -1.082 6.0e-06
breast carcinoma -1.300 6.3e-22
ductal carcinoma in situ -1.200 8.6e-03
invasive ductal carcinoma -2.400 4.0e-04
ulcerative colitis 1.400 4.3e-04
ovarian cancer -2.900 3.9e-13
pituitary cancer -2.300 8.8e-08
pancreatic cancer 1.700 1.6e-03

Synonym

Accession Q8N2G6 Q5U5T9 Q8TAG0
Symbols Z3CXXC8
C10orf56

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPEPTAGAAPPELAFGKGRPEQLGSPLHSS      1 - 70
YLNSFFQLQRGEALSNSVYKGASPYGSLNNIADGLSSLTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNK     71 - 140
GHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSGNSWANMGQECIKCHINVYPHKQRPLEKP    141 - 210
DGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQ                                           211 - 241
//

Text Mined References (11)

PMID Year Title
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.