Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.23
PubTator Score 1.89

Knowledge Summary

Patent

No data available

Synonym

Accession Q8WW36
Symbols CNBP2
ZNF9L

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
S.cerevisiae OMA Inparanoid

 Compartment GO Term (0)

 HCA RNA Cell Line (1)

Pathway (1)

AA Sequence

MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNC      1 - 70
GRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVA     71 - 140
INCSKARPGQLLPLRQIPTSSQGMSQ                                                141 - 166
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18312684 2008 A software application for comparing large numbers of high resolution MALDI-FTICR MS spectra demonstrated by searching candidate biomarkers for glioma blood vessel formation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15961456 2005 Identification of nine human-specific frameshift mutations by comparative analysis of the human and the chimpanzee genome sequences.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12045143 2002 Comparative sequence analysis of the X-inactivation center region in mouse, human, and bovine.