Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.23
PubTator Score 1.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Azoospermia 110 3.206 1.6

Synonym

Accession Q8WW36
Symbols CNBP2
ZNF9L

Gene

  Ortholog (1)

Species Source Disease
Inparanoid OMA

 Compartment GO Term (0)

 HCA RNA Cell Line (1)

AA Sequence

MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNC      1 - 70
GRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVA     71 - 140
INCSKARPGQLLPLRQIPTSSQGMSQ                                                141 - 166
//

Text Mined References (7)

PMID Year Title