Property Summary

NCBI Gene PubMed Count 25
PubMed Score 11.68
PubTator Score 12.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.400 5.7e-03
ependymoma 1.800 2.7e-03
osteosarcoma 1.389 6.0e-04
group 4 medulloblastoma 1.500 1.6e-04
atypical teratoid / rhabdoid tumor 1.200 8.9e-03
primitive neuroectodermal tumor 1.300 4.1e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.6e-02
lung cancer 1.200 4.1e-02
Breast cancer -1.100 5.9e-04

Gene RIF (13)

PMID Text
26114892 Data indicate that some of the small molecules were validated as specific inhibitors of 3' terminal uridylyl transferase (TUTase) Zcchc11 (TUT4) activity.
25480299 Study identified TUT4 and TUT7 as uridylyl transferases for poly(A)+ mRNAs in humans and delineated in detail the action mechanism and molecular function of uridylation in the mRNA decay pathway.
24056962 miR-26a directly targets Lin28B and Zcchc11-two critical repressors of let-7 maturation.
23063654 Study identified TUT7, TUT4, and TUT2 as novel components of the miRNA biogenesis pathway.
22898984 Lin28 uses two different TUTases to control let-7 expression .
22006926 Terminal uridyltransferase enzyme Zcchc11 promotes cell proliferation independent of its uridyltransferase activity
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19703396 This study uncovers the role of TUT4 and Lin28 as specific suppressors of microRNA biogenesis, which has implications for stem cell research and cancer biology.
19703396 TUT4 adds an oligouridine tail to the pre-let-7, which blocks Dicer processing. Knockdown of TUT4 and Lin28 reduces the level of stem cell markers
19701194 Zcchc11 fine tunes IL-6 production by uridylating miR-26a.
16643855 We propose that ZCCHC11 is a unique TLR signal regulator, which interacts with TIFA after LPS treatment and suppresses the TRAF6-dependent activation of NF-kappaB.

AA Sequence

MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSPNRNSSKKNKQNDICIEKTEV      1 - 70
KSCKVNAANLPGPKDLGLVLRDQSHCKAKKFPNSPVKAEKATISQAKSEKATSLQAKAEKSPKSPNSVKA     71 - 140
EKASSYQMKSEKVPSSPAEAEKGPSLLLKDMRQKTELQQIGKKIPSSFTSVDKVNIEAVGGEKCALQNSP    141 - 210
RSQKQQTCTDNTGDSDDSASGIEDVSDDLSKMKNDESNKENSSEMDYLENATVIDESALTPEQRLGLKQA    211 - 280
EERLERDHIFRLEKRSPEYTNCRYLCKLCLIHIENIQGAHKHIKEKRHKKNILEKQEESELRSLPPPSPA    281 - 350
HLAALSVAVIELAKEHGITDDDLRVRQEIVEEMSKVITTFLPECSLRLYGSSLTRFALKSSDVNIDIKFP    351 - 420
PKMNHPDLLIKVLGILKKNVLYVDVESDFHAKVPVVVCRDRKSGLLCRVSAGNDMACLTTDLLTALGKIE    421 - 490
PVFIPLVLAFRYWAKLCYIDSQTDGGIPSYCFALMVMFFLQQRKPPLLPCLLGSWIEGFDPKRMDDFQLK    491 - 560
GIVEEKFVKWECNSSSATEKNSIAEENKAKADQPKDDTKKTETDNQSNAMKEKHGKSPLALETPNRVSLG    561 - 630
QLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSLNSQLVYEYVVERF    631 - 700
RAAYRYFACPQTKGGNKSTVDFKKREKGKISNKKPVKSNNMATNGCILLGETTEKINAEREQPVQCDEMD    701 - 770
CTSQRCIIDNNNLLVNELDFADHGQDSSSLSTSKSSEIEPKLDKKQDDLAPSETCLKKELSQCNCIDLSK    771 - 840
SPDPDKSTGTDCRSNLETESSHQSVCTDTSATSCNCKATEDASDLNDDDNLPTQELYYVFDKFILTSGKP    841 - 910
PTIVCSICKKDGHSKNDCPEDFRKIDLKPLPPMTNRFREILDLVCKRCFDELSPPCSEQHNREQILIGLE    911 - 980
KFIQKEYDEKARLCLFGSSKNGFGFRDSDLDICMTLEGHENAEKLNCKEIIENLAKILKRHPGLRNILPI    981 - 1050
TTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLS   1051 - 1120
SYAYILMVLYFLQQRKPPVIPVLQEIFDGKQIPQRMVDGWNAFFFDKTEELKKRLPSLGKNTESLGELWL   1121 - 1190
GLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAFINGRK   1191 - 1260
LFGTPFYPLIGREAEYFFDSRVLTDGELAPNDRCCRVCGKIGHYMKDCPKRKSLLFRLKKKDSEEEKEGN   1261 - 1330
EEEKDSRDVLDPRDLHDTRDFRDPRDLRCFICGDAGHVRRECPEVKLARQRNSSVAAAQLVRNLVNAQQV   1331 - 1400
AGSAQQQGDQSIRTRQSSECSESPSYSPQPQPFPQNSSQSAAITQPSSQPGSQPKLGPPQQGAQPPHQVQ   1401 - 1470
MPLYNFPQSPPAQYSPMHNMGLLPMHPLQIPAPSWPIHGPVIHSAPGSAPSNIGLNDPSIIFAQPAARPV   1471 - 1540
AIPNTSHDGHWPRTVAPNSLVNSGAVGNSEPGFRGLTPPIPWEHAPRPHFPLVPASWPYGLHQNFMHQGN   1541 - 1610
ARFQPNKPFYTQDRCATRRCRERCPHPPRGNVSE                                       1611 - 1644
//

Text Mined References (29)

PMID Year Title
26114892 2015 Identification of small molecule inhibitors of Zcchc11 TUTase activity.
25480299 2014 Uridylation by TUT4 and TUT7 marks mRNA for degradation.
24056962 2014 miR-26a enhances miRNA biogenesis by targeting Lin28B and Zcchc11 to suppress tumor growth and metastasis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23063654 2012 Mono-uridylation of pre-microRNA as a key step in the biogenesis of group II let-7 microRNAs.
22898984 2012 Lin28-mediated control of let-7 microRNA expression by alternative TUTases Zcchc11 (TUT4) and Zcchc6 (TUT7).
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22118463 2011 Lin28A and Lin28B inhibit let-7 microRNA biogenesis by distinct mechanisms.
22006926 2011 Terminal uridyltransferase enzyme Zcchc11 promotes cell proliferation independent of its uridyltransferase activity.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19703396 2009 TUT4 in concert with Lin28 suppresses microRNA biogenesis through pre-microRNA uridylation.
19701194 2009 Zcchc11-dependent uridylation of microRNA directs cytokine expression.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18172165 2008 Degradation of histone mRNA requires oligouridylation followed by decapping and simultaneous degradation of the mRNA both 5' to 3' and 3' to 5'.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16643855 2006 A novel Zinc finger protein, ZCCHC11, interacts with TIFA and modulates TLR signaling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12239557 2002 Gene regulation: reviving the message.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.