Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.28
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession Q8TBK6 Q9NXR4
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MATPMHRLIARRQAFDTELQPVKTFWILIQPSIVISEANKQHVRCQKCLEFGHWTYECTGKRKYLHRPSR      1 - 70
TAELKKALKEKENRLLLQQSIGETNVERKAKKKRSKSVTSSSSSSSDSSASDSSSESEETSTSSSSEDSD     71 - 140
TDESSSSSSSSASSTTSSSSSDSDSDSSSSSSSSTSTDSSSDDEPPKKKKKK                      141 - 192
//

Text Mined References (7)

PMID Year Title