Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.28
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

 Compartment GO Term (2)

AA Sequence

MATPMHRLIARRQAFDTELQPVKTFWILIQPSIVISEANKQHVRCQKCLEFGHWTYECTGKRKYLHRPSR      1 - 70
TAELKKALKEKENRLLLQQSIGETNVERKAKKKRSKSVTSSSSSSSDSSASDSSSESEETSTSSSSEDSD     71 - 140
TDESSSSSSSSASSTTSSSSSDSDSDSSSSSSSSTSTDSSSDDEPPKKKKKK                      141 - 192
//

Text Mined References (7)

PMID Year Title