Property Summary

NCBI Gene PubMed Count 18
PubMed Score 47.46
PubTator Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.100 5.3e-06
non-inflammatory breast cancer -1.400 1.3e-03

Gene RIF (2)

PMID Text
26056227 ZC4H2, an XLID gene, is required for the generation of a specific subset of CNS interneurons
23623388 ZC4H2 mutations are associated with arthrogryposis multiplex congenita and intellectual disability through impairment of central and peripheral synaptic plasticity.

AA Sequence

MADEQEIMCKLESIKEIRNKTLQMEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKMAHVEELRLIH      1 - 70
ADINVMENTIKQSENDLNKLLESTRRLHDEYKPLKEHVDALRMTLGLQRLPDLCEEEEKLSLDYFEKQKA     71 - 140
EWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFRQQPPPMKACLSCHQQIHRNAPICPLCKAKS    141 - 210
RSRNPKKPKRKQDE                                                            211 - 224
//

Text Mined References (18)

PMID Year Title
26056227 2015 ZC4H2, an XLID gene, is required for the generation of a specific subset of CNS interneurons.
25416956 2014 A proteome-scale map of the human interactome network.
23623388 2013 ZC4H2 mutations are associated with arthrogryposis multiplex congenita and intellectual disability through impairment of central and peripheral synaptic plasticity.
21668950 2011 A computational approach to candidate gene prioritization for X-linked mental retardation using annotation-based binary filtering and motif-based linear discriminatory analysis.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
19132878 2009 Zinc fingers as biologic redox switches?
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17210253 2007 Sticky fingers: zinc-fingers as protein-recognition motifs.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12097419 2002 Large scale identification of human hepatocellular carcinoma-associated antigens by autoantibodies.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.