Property Summary

NCBI Gene PubMed Count 20
PubMed Score 55.66
PubTator Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-inflammatory breast cancer -1.400 1.3e-03
sonic hedgehog group medulloblastoma 1.100 5.3e-06

Gene RIF (3)

AA Sequence

MADEQEIMCKLESIKEIRNKTLQMEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKMAHVEELRLIH      1 - 70
ADINVMENTIKQSENDLNKLLESTRRLHDEYKPLKEHVDALRMTLGLQRLPDLCEEEEKLSLDYFEKQKA     71 - 140
EWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFRQQPPPMKACLSCHQQIHRNAPICPLCKAKS    141 - 210
RSRNPKKPKRKQDE                                                            211 - 224
//

Text Mined References (20)

PMID Year Title