Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 2.8e-02

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.100 2.8e-02

Gene RIF (1)

AA Sequence

MAEPTVCSFLTKVLCAHGGRMFLKDLRGHVELSEARLRDVLQRAGPERFLLQEVETQEGLGDAEAEAAAG      1 - 70
AVGGGGTSAWRVVAVSSVRLCARYQRGECQACDQLHFCRRHMLGKCPNRDCWSTCTLSHDIHTPVNMQVL     71 - 140
KSHGLFGLNENQLRILLLQNDPCLLPEVCLLYNKGEALYGYCNLKDKCNKFHVCKSFVKGECKLQTCKRS    141 - 210
HQLIHAASLKLLQDQGLNIPSVVNFQIISTYKHMKLHKMLENTDNSSPSTEHSQGLEKQGVHAAGAAEAG    211 - 280
PLASVPAQSAKKPCPVSCEK                                                      281 - 300
//

Text Mined References (10)

PMID Year Title