Property Summary

NCBI Gene PubMed Count 34
PubMed Score 143.19
PubTator Score 104.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.200 3.4e-04
astrocytoma 1.400 2.0e-23
Astrocytoma, Pilocytic 1.500 2.4e-06
Atopic dermatitis 1.700 1.2e-05
cutaneous lupus erythematosus 1.900 6.7e-04
cystic fibrosis 1.200 7.2e-03
dermatomyositis 1.400 4.2e-03
ependymoma 1.200 1.3e-07
glioblastoma 1.200 1.7e-06
group 4 medulloblastoma -1.600 3.1e-04
intraductal papillary-mucinous adenoma (... 1.400 1.5e-02
intraductal papillary-mucinous carcinoma... 1.200 4.4e-02
juvenile dermatomyositis 1.596 7.2e-15
lung cancer -1.400 2.5e-03
Multiple Sclerosis 1.400 7.2e-03
oligodendroglioma 1.200 1.2e-13
osteosarcoma 1.186 4.5e-05
ovarian cancer -1.500 9.1e-06
Pick disease 1.100 8.1e-03
psoriasis 1.100 7.3e-32
subependymal giant cell astrocytoma 2.313 4.4e-03
ulcerative colitis 1.400 1.5e-05

 MGI Phenotype (1)

Gene RIF (23)

AA Sequence

MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRA      1 - 70
RVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQ     71 - 140
SDPFFMPEICKSYKGEGRQQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPD    141 - 210
VVQNIQDICNSKHMQKNPPGPRAPSSHRRNMAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDQIS    211 - 280
HRASLEDAPVDDLTRKFTYLGSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLA    281 - 350
SNSTSAPNWKSLTSWTNDQGARRKTVFSPTLPAARSSLGSLQTPEAVTTRKGTGLLSSDYRIINGKSGTQ    351 - 420
DIQPGPLFNNNADGVATDITSTRSLNYKSTSSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVN    421 - 490
DSLSDVTSTTSSRVDDHDSEEICLDHLCKGCPLNGSCSKVHFHLPYRWQMLIGKTWTDFEHMETIEKGYC    491 - 560
NPGIHLCSVGSYTINFRVMSCDSFPIRRLSTPSSVTKPANSVFTTKWIWYWKNESGTWIQYGEEKDKRKN    561 - 630
SNVDSSYLESLYQSCPRGVVPFQAGSRNYELSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPDH    631 - 700
QPAKTSSVSLTATFRPQEDFCFLSSKKYKLSEIHHLHPEYVRVSEHFKASMKNFKIEKIKKIENSELLDK    701 - 770
FTWKKSQMKEEGKLLFYATSRAYVESICSNNFDSFLHETHENKYGKGIYFAKDAIYSHKNCPYDAKNVVM    771 - 840
FVAQVLVGKFTEGNITYTSPPPQFDSCVDTRSNPSVFVIFQKDQVYPQYVIEYTEDKACVIS            841 - 902
//

Text Mined References (52)

PMID Year Title