Property Summary

NCBI Gene PubMed Count 19
PubMed Score 2.87
PubTator Score 3.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.300 8.4e-04
astrocytic glioma 1.700 1.6e-02
atypical teratoid / rhabdoid tumor -1.500 7.9e-07
ependymoma 2.100 7.8e-04
esophageal adenocarcinoma 1.200 2.6e-02
glioblastoma -1.400 7.9e-05
intraductal papillary-mucinous adenoma (... 1.100 5.6e-03
intraductal papillary-mucinous carcinoma... 1.400 1.3e-02
malignant mesothelioma -1.300 6.6e-07
medulloblastoma, large-cell -1.500 2.4e-05
Multiple myeloma -1.368 4.5e-02
oligodendroglioma 2.000 5.8e-04
ovarian cancer -1.900 2.7e-04
pancreatic ductal adenocarcinoma liver m... 2.118 5.7e-03
Pick disease 1.500 2.5e-07

Gene RIF (8)

AA Sequence

MERQKRKADIEKGLQFIQSTLPLKQEEYEAFLLKLVQNLFAEGNDLFREKDYKQALVQYMEGLNVADYAA      1 - 70
SDQVALPRELLCKLHVNRAACYFTMGLYEKALEDSEKALGLDSESIRALFRKARALNELGRHKEAYECSS     71 - 140
RCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETFSLLSNGTAAGVADQGTSNGLGSIDDIETGN    141 - 210
VPDTREQVEIGAPRDCYVDPRGSPALLPSTPTMPLFPHVLDLLAPLDSSRTLPSTDSLDDFSDGDVFGPE    211 - 280
LDTLLDSLSLVQGGLSGSGVPSELPQLIPVFPGGTPLLPPVVGGSIPVSSPLPPASFGLVMDPSKKLAAS    281 - 350
VLDALDPPGPTLDPLDLLPYSETRLDALDSFGSTRGSLDKPDSFMEETNSQDHRPPSGAQKPAPSPEPCM    351 - 420
PNTALLIKNPLAATHEFKQACQLCYPKTGPRAGDYTYREGLEHKCKRDILLGRLRSSEDQTWKRIRPRPT    421 - 490
KTSFVGSYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDLLFDPLGGVKRGSLTIAKLLK    491 - 560
EHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNLAAKHSFYNNKCLVHIVRSTSLKYSKIRQFQEHFQF    561 - 630
DVCRHEVRYGCLREDSCHFAHSFIELKVWLLQQYSGMTHEDIVQESKKYWQQMEAHAGKASSSMGAPRTH    631 - 700
GPSTFDLQMKFVCGQCWRNGQVVEPDKDLKYCSAKARHCWTKERRVLLVMSKAKRKWVSVRPLPSIRNFP    701 - 770
QQYDLCIHAQNGRKCQYVGNCSFAHSPEERDMWTFMKENKILDMQQTYDMWLKKHNPGKPGEGTPISSRE    771 - 840
GEKQIQMPTDYADIMMGYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDASGWAFRFPMGEFRLCDR    841 - 910
LQKGKACPDGDKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLLCPRDDDFGKYNFLLQEDGDLAGATP    911 - 980
EAPAAAATATTGE                                                             981 - 993
//

Text Mined References (25)

PMID Year Title