Property Summary

NCBI Gene PubMed Count 40
PubMed Score 69.51
PubTator Score 38.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.600 1.1e-05
psoriasis 3.700 6.9e-267
Atopic dermatitis 1.700 4.6e-04
adrenocortical carcinoma -1.844 1.7e-06
tuberculosis -1.300 3.0e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.9e-02
lung cancer -2.000 1.0e-05
active Crohn's disease 1.170 4.4e-02
ulcerative colitis 2.700 6.7e-10
pancreatic cancer 1.200 4.2e-02
cystic fibrosis 1.400 2.0e-05
non-inflammatory breast cancer -1.300 2.1e-02
pituitary cancer -1.400 4.3e-03

Gene RIF (27)

PMID Text
26617772 Suggest that MCPIP1 may play an important role in cholesterol induced damage in endothelial cells.
26450708 miR-139-mediated downregulation of MCPIP1 promotes IL-6 expression in osteoarthritis.
26399696 demonstrated induction of MCPIP1 in human fibroblasts embedded in the stress-released 3-D collagen matrix, which occurred through activation of mitogen-activated protein kinases, phosphoinositide 3-kinase, and NF-kappaB
26329288 Findings show increased MCP1P expression in a model of Ischemia/Reperfusion Injury (I/R) and suggest a vital role for MCPIP1 in cell migration and apoptosis, resulting in increased angiogenesis and apoptosis during the late stages of I/R.
26315540 In white blood cells from patients with SLE, MCPIP1 expression was elevated, and its expression correlated positively with the IFN score and negatively with the miR-146a transcript level.
26134560 MCPIP1 and MCPIP4 form a complex but they act independently in regulation of IL-6 mRNA degradation.
25955820 In this review we summarize current progress regarding the specific characteristics of sequences and structures in the 3' untranslated regions of mRNAs that are recognized by tristetraproline, Roquins, and Regnase-1.
25225661 MCPIP1 may suppress hepatitis C virus replication and hepatitis C virus-mediated proinflammatory responses with infection, which might contribute to the regulation of host defense against the infection and virus-induced inflammation.
25187114 Data show that regulator of G protein signaling 2 (RGS2) was stabilized by deubiquitinase monocyte chemotactic protein-induced protein 1 (MCPIP1).
24270572 MCPIP1-associated USP10 is essential for negative regulation of NF-kappaB activation.
24191027 MCPIP1 acts as an RNase to limit HIV-1 production in resting CD4+ T cells.
24048733 The present results show for the first time that the antidicer RNase activity of MCPIP1 is critical in mediating the angiogenic function of MCPIP.
24008336 These results demonstrate that MCPIP may be an important regulator of inflammatory angiogenesis and provide novel mechanistic insights into the link between MCP-1 and cardiovascular diseases.
23658019 MCPIP1 is regulated by IL-17 and IL-1
23355615 MCPIP1 can act as a host innate defense via RNase activity for targeting and degrading viral RNA.
23185455 Taken together, these data demonstrate that MCPIP1 down-regulates via an ARE-independent pathway
22820500 MCPIP-induces differentiation via induction of oxidative stress that leads to ER stress that causes autophagy involved in tube formation.
22196138 Data indicate that absence of MCPIP1 exacerbates ischemic brain damage by upregulation of proinflammatory cytokines and that MCPIP1 participates in LPS-induced ischemic stroke tolerance.
22132693 Our data suggest that Zc3h12a is a novel IL-6 regulator in fibroblast-like synovial cells, which may be involved in the progression of rheumatoid arthritis.
22055188 MCPIP1 ribonuclease antagonizes dicer and terminates microRNA biogenesis through precursor microRNA degradation.
21971051 MCPIP1 coordinates SG formation and apoptosis during cellular stress and may play a critical role in immune homeostasis and resolution of macrophage inflammation.
20807520 REVIEW: Understanding ZC3H12A gives a comprehensive panorama that promises to improve our understanding of processes in which this gene is involved including autoimmune, infectious and cardiovascular diseases.
19747262 Observations provide evidence for a novel negative feedback loop in the activation of NF-kappaB and point to potential significance of MCPIP in the treatment of pathological states that involve disturbances in the functioning of the NF-kappaB system.
19185603 data demonstrate the role amyloid precursor protein (APP) has in glial differentiation of NT2 cells through MCP-1(MCP-1)/MCP-1-induced protein (MCPIP) signaling
18364357 MCP-1-induced angiogenesis is mediated via MCPIP, at least in part through transcriptional activation of cdh12 and cdh19
18178554 MCPIP1, 2, 3, and 4, encoded by four genes, Zc3h12a, Zc3h12b, Zc3h12c, and Zc3h12d, respectively, regulates macrophage activation.
16574901 May cause cell death and plays important role in development of ischemic heart disease. Could be a potential target for therapeutic intervention.

AA Sequence

MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQMKVDFFRKLGYSSTEIHSVLQ      1 - 70
KLGVQADTNTVLGELVKHGTATERERQTSPDPCPQLPLVPRGGGTPKAPNLEPPLPEEEKEGSDLRPVVI     71 - 140
DGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVF    141 - 210
TPSRRVGGKRVVCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDP    211 - 280
LGRHGPSLDNFLRKKPLTLEHRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPS    281 - 350
KDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAPSGGSGSSFGPTDW    351 - 420
LPQTLDSLPYVSQDCLDSGIGSLESQMSELWGVRGGGPGEPGPPRAPYTGYSPYGSELPATAAFSAFGRA    421 - 490
MGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGRSPWGRAGSLAKEQASVYTKL    491 - 560
CGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPSE                                   561 - 599
//

Text Mined References (48)

PMID Year Title
26617772 2015 MCPIP is induced by cholesterol and participated in cholesterol-caused DNA damage in HUVEC.
26450708 2015 miR-139 modulates MCPIP1/IL-6 expression and induces apoptosis in human OA chondrocytes.
26399696 2015 MCPIP1 Regulates Fibroblast Migration in 3-D Collagen Matrices Downstream of MAP Kinases and NF-?B.
26329288 2015 The Role of MCPIP1 in Ischemia/Reperfusion Injury-Induced HUVEC Migration and Apoptosis.
26320658 2015 MCPIP1 Endoribonuclease Activity Negatively Regulates Interleukin-17-Mediated Signaling and Inflammation.
26315540 2015 Type I Interferon Inhibition of MicroRNA-146a Maturation Through Up-Regulation of Monocyte Chemotactic Protein-Induced Protein 1 in Systemic Lupus Erythematosus.
26134560 2015 Monocyte Chemotactic Protein-induced Protein 1 and 4 Form a Complex but Act Independently in Regulation of Interleukin-6 mRNA Degradation.
25955820 2015 Emerging Roles of CCCH-Type Zinc Finger Proteins in Destabilizing mRNA Encoding Inflammatory Factors and Regulating Immune Responses.
25861989 2015 TRAF Family Member-associated NF-?B Activator (TANK) Inhibits Genotoxic Nuclear Factor ?B Activation by Facilitating Deubiquitinase USP10-dependent Deubiquitination of TRAF6 Ligase.
25416956 2014 A proteome-scale map of the human interactome network.
25225661 2014 MCPIP1 suppresses hepatitis C virus replication and negatively regulates virus-induced proinflammatory cytokine responses.
25187114 2015 RGS2 suppresses breast cancer cell growth via a MCPIP1-dependent pathway.
24270572 2013 USP10 inhibits genotoxic NF-?B activation by MCPIP1-facilitated deubiquitination of NEMO.
24191027 2013 MCPIP1 restricts HIV infection and is rapidly degraded in activated CD4+ T cells.
24048733 2013 Antidicer RNAse activity of monocyte chemotactic protein-induced protein-1 is critical for inducing angiogenesis.
24008336 2013 MCP-1-induced protein promotes endothelial-like and angiogenic properties in human bone marrow monocytic cells.
23658019 2013 Interleukin-17 (IL-17) and IL-1 activate translation of overlapping sets of mRNAs, including that of the negative regulator of inflammation, MCPIP1.
23500036 mRNA degradation by the endoribonuclease Regnase-1/ZC3H12a/MCPIP-1.
23355615 2013 MCPIP1 ribonuclease exhibits broad-spectrum antiviral effects through viral RNA binding and degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23185455 2012 MCPIP1 down-regulates IL-2 expression through an ARE-independent pathway.
22820500 2012 Monocyte chemotactic protein-induced protein (MCPIP) promotes inflammatory angiogenesis via sequential induction of oxidative stress, endoplasmic reticulum stress and autophagy.
22739135 2012 MCP-1 induced protein promotes adipogenesis via oxidative stress, endoplasmic reticulum stress and autophagy.
22561375 2012 Structural study of MCPIP1 N-terminal conserved domain reveals a PIN-like RNase.
22196138 2011 Participation of MCP-induced protein 1 in lipopolysaccharide preconditioning-induced ischemic stroke tolerance by regulating the expression of proinflammatory cytokines.
22132693 Post-transcriptional regulation of IL-6 production by Zc3h12a in fibroblast-like synovial cells.
22055188 2011 MCPIP1 ribonuclease antagonizes dicer and terminates microRNA biogenesis through precursor microRNA degradation.
22037600 2011 The I?B kinase complex regulates the stability of cytokine-encoding mRNA induced by TLR-IL-1R by controlling degradation of regnase-1.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21971051 2011 Monocyte chemotactic protein-induced protein 1 (MCPIP1) suppresses stress granule formation and determines apoptosis under stress.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
20807520 2010 ZC3H12A (MCPIP1): molecular characteristics and clinical implications.
20137095 2010 Transcription factors Elk-1 and SRF are engaged in IL1-dependent regulation of ZC3H12A expression.
19909337 2009 Interleukin-1-inducible MCPIP protein has structural and functional properties of RNase and participates in degradation of IL-1beta mRNA.
19747262 2009 Regulatory feedback loop between NF-kappaB and MCP-1-induced protein 1 RNase.
19185603 2009 MCP-1 involvement in glial differentiation of neuroprogenitor cells through APP signaling.
18364357 2008 Monocyte chemotactic protein (MCP)-1 promotes angiogenesis via a novel transcription factor, MCP-1-induced protein (MCPIP).
18178554 2008 A novel CCCH-zinc finger protein family regulates proinflammatory activation of macrophages.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16574901 2006 Monocyte chemoattractant protein-1 induces a novel transcription factor that causes cardiac myocyte apoptosis and ventricular dysfunction.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.