Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.22
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 4.9e-09
atypical teratoid / rhabdoid tumor 5112 1.9e-07
glioblastoma 5792 1.1e-05
medulloblastoma, large-cell 6241 1.1e-05
osteosarcoma 7950 1.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Systemic scleroderma 60 0.0 2.9

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.9e-07
glioblastoma 1.100 1.1e-05
medulloblastoma, large-cell 1.200 1.1e-05
osteosarcoma -1.110 1.3e-04
ovarian cancer 1.100 4.9e-09

Gene RIF (2)

AA Sequence

MPDRDSYANGTGSSGGGPGGGGSEEASGAGVGSGGASSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLG      1 - 70
VSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVAAGLGLSPADLPNGKEEVPIC     71 - 140
RDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGTGGGSTGSVLPGRRHDLYDIYDLPDRGFEDHEPGPKRR    141 - 210
RGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAK    211 - 280
VITLSSTAPATEQTLAPTVGTVATFNHGIAQTHTTLSSQALQPRPVSQQELVAPAGAPAAPPTNAAPPAA    281 - 350
PPPPPPHLTPEITPLSAALAQTIAQGMAPPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTY    351 - 420
PIASQSMRITAMPH                                                            421 - 434
//

Text Mined References (13)

PMID Year Title