Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.08

Knowledge Summary


No data available


  Disease (2)


  Differential Expression (6)

Disease log2 FC p
chronic rhinosinusitis -1.224 1.2e-02
cystic fibrosis and chronic rhinosinusit... -1.025 4.1e-02
ependymoma 2.000 5.1e-10
fibroadenoma 1.200 7.0e-04
malignant mesothelioma -1.700 6.4e-06
nasopharyngeal carcinoma -1.100 1.8e-07

AA Sequence

FDSSRARAKGTELEQYLNWKGPASAKAEPPQKSNWR                                      421 - 456

Text Mined References (8)

PMID Year Title