Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.42
PubTator Score 0.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
cutaneous lupus erythematosus -1.600 1.1e-03
atypical teratoid / rhabdoid tumor -1.900 1.0e-04
glioblastoma -1.300 2.9e-03
medulloblastoma, large-cell -1.600 5.3e-03
adrenocortical carcinoma 1.102 2.4e-05
pancreatic ductal adenocarcinoma liver m... 1.306 7.7e-03
lung cancer -1.700 1.0e-02
adult high grade glioma -1.200 2.8e-04
Breast cancer -1.700 1.8e-05
acute myeloid leukemia -1.700 3.0e-03
ovarian cancer -1.300 9.2e-04
chronic rhinosinusitis -1.961 8.5e-03
cystic fibrosis and chronic rhinosinusit... -1.698 1.1e-02

Synonym

Accession Q96GY0 Q9Y372
Symbols CGI-62
C8orf70
FAM164A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPR      1 - 70
PEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINF     71 - 140
CKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSS    141 - 210
SSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSL    211 - 280
NGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL                             281 - 325
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.