Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.42
PubTator Score 0.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.700 3.0e-03
adrenocortical carcinoma 1.001 8.7e-05
adult high grade glioma -1.200 2.8e-04
atypical teratoid / rhabdoid tumor -1.500 8.6e-05
Breast cancer -1.700 1.8e-05
chronic rhinosinusitis -1.388 5.4e-03
cutaneous lupus erythematosus -1.600 1.1e-03
cystic fibrosis and chronic rhinosinusit... -1.084 2.1e-02
glioblastoma -1.100 5.1e-03
lung cancer -1.700 1.0e-02
medulloblastoma, large-cell -1.100 2.4e-03
ovarian cancer -1.100 2.4e-04
pancreatic ductal adenocarcinoma liver m... 1.306 7.7e-03

AA Sequence

MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPR      1 - 70
PEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINF     71 - 140
CKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSS    141 - 210
SSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSL    211 - 280
NGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL                             281 - 325
//

Text Mined References (13)

PMID Year Title