Property Summary

NCBI Gene PubMed Count 36
PubMed Score 62.81
PubTator Score 32.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Birth length 3
Disease Target Count P-value
ovarian cancer 8491 1.8e-05
active Crohn's disease 918 3.8e-02

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.293 3.8e-02
ovarian cancer -1.100 1.8e-05

Gene RIF (12)

PMID Text
23609452 a novel pathway by which TIP60 and ThPOK synergistically suppresses Eomes function and IFNgamma production, which could contribute to the regulation of inflammation.
23349906 ThPOK may be considered a central regulator of the earliest events in the immune system during colorectal cancer development, decreasing the immune response against cancer cells.
23315079 The distal regulatory element (DRE) in the Thpok gene also functions as a transcriptional enhancer, with DNA sequences specifically responsible for thymic enhancer activity.
22730529 ThPOK transgene stably represses CD8 gene expression through the deacetylation of Cd8 loci in CD4 cell lineage commitment.
22139845 The p65 subunit of NF-kappaB inhibits COL1A1 gene transcription in human dermal and scleroderma fibroblasts through its recruitment on promoter by protein interaction with transcriptional activators (c-Krox, Sp1, and Sp3).
20847520 comparing the promoter regions of the Th-POK gene between human and mouse, the region 3600 base pairs upstream from the transcription initiation site of the Th-POK gene was highly conserved
20810990 impairment of Lck-mediated CD4 coreceptor signaling by Nef is an important in vivo mechanism of HIV-1 pathogenesis
19886737 Thymoma neoplastic epithelial cells can induce Th-POK expression in T-cell subsets similarly to the normal thymic epithelial cells. In addition, there was no significant difference in Runx3 expression in T-cell subsets between normal thymi and thymomas.
19479890 Runx and ThPOK role in mechanisms of lineage-specific gene regulation in the process of T-cell commitments[review]
19453261 Observational study of gene-disease association. (HuGE Navigator)
18298657 Chondroitin sulphate and its derived hydrolytic fragments (CSf) repress COL1A1 gene transcription through a -112/-61 bp sequence upstream the start site of transcription and imply hc-Krox and Sp1 transcription factors.
17698844 These data suggest that the regulation of COL1A1 gene transcription in human dermal fibroblasts involves a complex machinery that implicates at least three transcription proteins, hc-Krox, Sp1, and Sp3.

AA Sequence

MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFKKLFTEGGGGA      1 - 70
VMGAGGSGTATGGAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAACMEI     71 - 140
LQGSGLEAPSPDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRKAFLQ    141 - 210
TKGARANHLVPEVPTVPAHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEE    211 - 280
ELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPV    281 - 350
CHKIIHGAGKLPRHMRTHTGEKPFACEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYDLKNH    351 - 420
MHLHTGDRPYECHLCHKAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAASPAGLDLSNGH    421 - 490
LDTFRLSLARFWEQSAPTGPPVSTPGPPDDDEEEGAPTTPQAEGAMESS                         491 - 539
//

Text Mined References (41)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25281659 2015 A novel common variant in DCST2 is associated with length in early life and height in adulthood.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23609452 2013 60-kDa Tat-interactive protein (TIP60) positively regulates Th-inducing POK (ThPOK)-mediated repression of eomesodermin in human CD4+ T cells.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23349906 2013 Th inducing POZ-Kruppel Factor (ThPOK) is a key regulator of the immune response since the early steps of colorectal carcinogenesis.
23315079 2013 Cutting edge: fine-tuning of Thpok gene activation by an enhancer in close proximity to its own silencer.
22730529 2012 Epigenetic silencing of CD8 genes by ThPOK-mediated deacetylation during CD4 T cell differentiation.
22246292 2012 Genetic and epigenetic mechanisms collaborate to control SERPINA3 expression and its association with placental diseases.
22139845 2012 The p65 subunit of NF-?B inhibits COL1A1 gene transcription in human dermal and scleroderma fibroblasts through its recruitment on promoter by protein interaction with transcriptional activators (c-Krox, Sp1, and Sp3).
21948191 2011 Transcriptional control of T-cell development.
21762816 2011 Transcriptional and epigenetic regulation of CD4/CD8 lineage choice.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21357543 2011 Regulation of GATA-3 expression during CD4 lineage differentiation.
20969593 2010 Expanding roles for ThPOK in thymic development.
20847520 2010 Identification of important regulatory region of Th-POK.
20810990 2010 p300-mediated acetylation stabilizes the Th-inducing POK factor.
20809492 2010 Directing traffic on the NKT-cell highway: a key role for ThPOK.
20307210 2010 The role of ThPOK in control of CD4/CD8 lineage commitment.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19886737 2009 Regulation of Th-POK and Runx3 in T cell development in human thymoma.
19696430 2009 CD4-CD8 lineage differentiation: Thpok-ing into the nucleus.
19479890 2009 Runx and ThPOK: a balancing act to regulate thymocyte lineage commitment.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18800158 2008 Putting ThPOK in place.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18298657 2008 Chondroitin sulphate decreases collagen synthesis in normal and scleroderma fibroblasts through a Smad-independent TGF-beta pathway--implication of C-Krox and Sp1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17698844 2007 Human collagen Krox up-regulates type I collagen expression in normal and scleroderma fibroblasts through interaction with Sp1 and Sp3 transcription factors.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11691585 2001 The hcKrox gene family regulates multiple extracellular matrix genes.
10856292 2000 Regulation of human COL2A1 gene expression in chondrocytes. Identification of C-Krox-responsive elements and modulation by phenotype alteration.
9421237 1997 Functional characterization of the human biglycan 5'-flanking DNA and binding of the transcription factor c-Krox.
9370309 1997 Cloning and characterization of hcKrox, a transcriptional regulator of extracellular matrix gene expression.
7937772 1994 c-Krox, a transcriptional regulator of type I collagen gene expression, is preferentially expressed in skin.