Property Summary

NCBI Gene PubMed Count 63
PubMed Score 115.57
PubTator Score 106.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (56)

PMID Text
26816381 this study found that LRF/ZBTB7A transcription factor occupies fetal gamma-globin genes and maintains the nucleosome density necessary for gamma-globin gene silencing in adults, and that LRF confers its repressive activity through a NuRD repressor complex independent of the fetal globin repressor BCL11A.
26164003 MEF2D was also found to increase the transcription of Pokemon by binding myocyte enhancer factor 2 (MEF2) sites within its promoter region, that can promote Hepatocellular carcinoma invasion
25995384 ZBTB7A directly binds to the promoter and transcriptionally represses the expression of MCAM, establishing ZBTB7A as a bona fide transcriptional repressor of MCAM
25722217 our findings suggest that TGF-b1 may inhibit the expression of Pokemon, b-catenin, and E-cadherin. The high expression of TGF-b1 leads to an increase in the phenotype and apical-base polarity of epithelial cells
25514493 Taken together, all these data suggest that Pokemon is a new partner of Smad4 and plays a negative role in TGF-beta pathway.
25367850 Pokemon enhanced the oncogenesis of colorectal cancer by promoting cell proliferation, cell cycle progression and anti-apoptosis activity.
25184678 ZBTB7A, a member of the POK (POZ/BTB and Kruppel) transcription repressor family, directly binds to the promoter and represses the transcription of critical glycolytic genes, including GLUT3, PFKP, and PKM
24857950 a potential regulatory role of FBI-1 in transcription factor activity of ETS-1
24514149 An unexpected function for FBI-1 in splicing modulation with a direct impact on cell survival.
24393848 Investigated the functions of Pokemon in the carcinogenesis and development of bladder cancer and observed the inhibitory effects of siRNA expression vector on Pokemon in bladder cancer cells.
24377524 Pokemon expression of NP69 and C666-1 obviously varied from mRNA to protein.
24326827 For the first time, we show that LRF/Pokemon is predominantly expressed in nodular lymphocyte-predominant Hodgkin lymphoma with low to absent NOTCH1 protein expression
24261083 our results may help better understand the role of Pokemon in hepatocellular carcinoma and promote the clinical applications
24175766 The mRNA expression level of Pokemon in colorectal adenocarcinoma was significantly higher than that in adjacent tumor specimens. The positive expression ratio of Pokemon protein in colorectal cancer was significantly higher than in the adjacent tissues.
23924858 Knockdown of Pokemon protein expression inhibits hepatocellular carcinoma cell proliferation by suppression of AKT activity.
23911422 Data indicate that ZBTB7A is identified as a strong candidate for regulation of thymic insulin expression.
23874836 Pokemon might serve as an important mediator of crosstalk between intrinsic and extrinsic apoptotic pathways in HCC cel
23807508 p38beta is a novel regulatory target of the transcription factor Pokemon and positively regulated by Pokemon in hepatic cells.
23727861 ZBTB7A is a context-dependent cancer gene that can act as an oncogene in some contexts but also has oncosuppressive-like activity in PTEN-null tumors.
23396304 Studies indicate that LRF regulates hematopoiesis by playing specific roles in different cell lineages.
23300578 Pokemon promotes cell proliferation and migration in hepatocellular carcinoma and accelerates tumor development.
23054188 Pokemon activates the expression of both p65 and IkappaBalpha by sequence-specific binding to their promoters and plays a dual role in regulating NF-kappaB signaling.
22847180 The oncogene LRF is a survival factor in chondrosarcoma and contributes to tumor malignancy and drug resistance.
22754333 Pokemon prevents anoikis through the suppression of Bim expression, which facilitates tumor cell invasion and metastasis.
22447046 The activities of CDK2 and E2F4 promoters were suppressed by the modulation of Zbtb7 levels and that Zbtb7 represses promoter activities through a mechanism involving direct binding of Zbtb7 to the promoters.
21985851 Depletion of Pokemon inhibited proliferation of HepG(2) or induced apoptosis.
21771706 siRNA of Pokemon was applied to inhibit the expression of Pokemon and NF-kappa B p65 and apoptotic rate was determined by flow cytometric analysis
21713761 The current findings indicated that FBI-1 plays an important role in HCC carcinogenesis and chemotherapy tolerance
21640721 The aim of this study was to examine the regulation of LRF expression in human prostate cells.
21590684 FBI-1/OCZF/LRF regulates osteoclast formation and apoptosis in vivo, and may become a useful marker and target in treating disorders leading to reduced bone density, including chronic arthritis.
21392388 Pokemon promotes breast cancer progression by upregulating survivin expression and may be a potential target for the treatment of this malignancy
21251909 The expression of LRF was evaluated in benign prostate hyperplastic (BPH) and prostate cancer (PC) tissues.
21176152 knockdown of MT1-MMP abolished FBI-1-mediated cell migration and invasion. Conversely, stable knockdown of FBI-1 remarkably reduced the motility of these cells with decreased expression of MT1-MMP.
20923760 analysis of the miRNA-mediated interaction between leukemia/lymphoma-related factor (LRF) and alternative splicing factor/splicing factor 2 (ASF/SF2) affects cell senescence and apoptosis
20812024 FBI-1 functions as a novel androgen receptor co-repressor in prostate cancer cells.
20394500 ZBTB7 might be implicated in breast cancer development and may serve as a promising prognostic marker.
20336405 This is the first report on the global mapping of ZBTB7A downstream direct targets, and these findings will be useful in understanding the roles of ZBTB7A in cellular processes.
19471103 Eukaryotic translation initiator protein 1A isoform, CCS-3, enhances the transcriptional repression of p21CIP1 by proto-oncogene FBI-1 (Pokemon/ZBTB7A).
19444642 Curcumin decreases the expression of Pokemon by suppressing the binding activity of the Sp1 protein in human lung cancer cells.
19244234 FBI-1 represses transcription of p21CIP1. FBI-1 interacted with p53 and Sp1. FBI-1 also interacted with corepressors, such as mSin3A, NCoR, and SMRT.
18801742 Proto-oncogene FBI-1 (Pokemon/ZBTB7A) represses transcription of the tumor suppressor Rb gene via binding competition with Sp1 and recruitment of co-repressors.
18682402 Proto-oncogene FBI-1 (Pokemon) and SREBP-1 synergistically activate transcription of fatty-acid synthase gene
18550205 Pokemon had some clinical significance for prognostic evaluation of the patients with non-small cell lung cancer
18482847 Through the two-step purification, Zbtb7A protein was purified in high purity and its production reached up to as high as 18 mg/L. These results indicated that an effective procedure for expressing and purifying human Zbtb7A in P. pastoris was established
18368381 FBI-1 is the first transcriptional repressor shown to act as a dual regulator in adipogenesis exerting repressor activities on target genes by both, direct and indirect mechanisms.
18355317 elucidate the mechanism underlying the regulation of Pokemon gene transcription, and also define a novel regulatory sequence that may be used to decrease expression of the Pokemon gene in cancer gene therapy
17595526 The sumoylation target lysine residue at amino acid 61, which is located in the middle of the POZ-domain, is important because K61R mutation resulted in a much weaker molecular interaction with corepressors.
15917220 FBI-1 enhances transcription of the NF-kappaB-responsive E-selectin gene by nuclear localization of the p65 subunit of NF-kappaB
15662416 Pokemon is aberrantly overexpressed in human cancers and that its expression levels predict biological behaviour and clinical outcome
14701838 may contribute to adipogenesis through influencing the switch from cellular proliferation to terminal differentiation
12750370 found that FBI-1 binds to inverted sequence repeats downstream of the HIV-1 transcription start site
12750370 Binding of FBI-1 to HIV-1 Tat is mediated by the zinc finger (ZF) domain of FBI-1 (amino acids 377-584) and is diminished by point mutations in Tat at amino acids 18, 30, and 31
12004059 POZ domain of FBI1 represses transcription of ADH5.
11907272 Results suggest that FBI-1 is a cellular factor that preferentially associates with active chromatin and that can specifically stimulate Tat-activated HIV-1 transcription.
11907272 Binding of FBI-1 to HIV-1 Tat is mediated by the zinc finger (ZF) domain of FBI-1 (amino acids 377-584) and is diminished by point mutations in Tat at amino acids 18, 30, and 31
9973611 Binding of FBI-1 to HIV-1 Tat is mediated by the zinc finger (ZF) domain of FBI-1 (amino acids 377-584) and is diminished by point mutations in Tat at amino acids 18, 30, and 31

AA Sequence

MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVD      1 - 70
QQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLDRQILAADAGADA     71 - 140
GQLDLVDQIDQRNLLRAKEYLEFFQSNPMNSLPPAAAAAAASFPWSAFGASDDDLDATKEAVAAAVAAVA    141 - 210
AGDCNGLDFYGPGPPAERPPTGDGDEGDSNPGLWPERDEDAPTGGLFPPPVAPPAATQNGHYGRGGEEEA    211 - 280
ASLSEAAPEPGDSPGFLSGAAEGEDGDGPDVDGLAASTLLQQMMSSVGRAGAAAGDSDEESRADDKGVMD    281 - 350
YYLKYFSGAHDGDVYPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFT    351 - 420
RQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGC    421 - 490
NGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKDEDEDEDVASPDGLGRLNVAG    491 - 560
AGGGGDSGGGPGAATDGNFTAGLA                                                  561 - 584
//

Text Mined References (74)

PMID Year Title
26816381 2016 Transcription factors LRF and BCL11A independently repress expression of fetal hemoglobin.
26164003 2015 Pokemon and MEF2D co-operationally promote invasion of hepatocellular carcinoma.
25995384 2015 ZBTB7A Suppresses Melanoma Metastasis by Transcriptionally Repressing MCAM.
25722217 2015 Evaluation of transforming growth factor-?1 suppress Pokemon/epithelial-mesenchymal transition expression in human bladder cancer cells.
25514493 2015 Pokemon (FBI-1) interacts with Smad4 to repress TGF-?-induced transcriptional responses.
25416956 2014 A proteome-scale map of the human interactome network.
25367850 2014 Pokemon enhances proliferation, cell cycle progression and anti-apoptosis activity of colorectal cancer independently of p14ARF-MDM2-p53 pathway.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25184678 2014 ZBTB7A acts as a tumor suppressor through the transcriptional repression of glycolysis.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24857950 2014 FBI-1 enhances ETS-1 signaling activity and promotes proliferation of human colorectal carcinoma cells.
24514149 2014 The transcription factor FBI-1 inhibits SAM68-mediated BCL-X alternative splicing and apoptosis.
24393848 2014 The effect of Pokemon on bladder cancer epithelial-mesenchymal transition.
24377524 2013 Expression of the Pokemon proto-oncogene in nasopharyngeal carcinoma cell lines and tissues.
24326827 2014 Utility of LRF/Pokemon and NOTCH1 protein expression in the distinction between nodular lymphocyte-predominant Hodgkin lymphoma and classical Hodgkin lymphoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24261083 2013 Investigation of Pokemon-regulated proteins in hepatocellular carcinoma using mass spectrometry-based multiplex quantitative proteomics.
24175766 2013 Expression of the proto-oncogene Pokemon in colorectal cancer--inhibitory effects of an siRNA.
23924858 2013 Knockdown of Pokemon protein expression inhibits hepatocellular carcinoma cell proliferation by suppression of AKT activity.
23911422 2013 Yeast one-hybrid screen of a thymus epithelial library identifies ZBTB7A as a regulator of thymic insulin expression.
23874836 2013 Silencing of Pokemon enhances caspase-dependent apoptosis via fas- and mitochondria-mediated pathways in hepatocellular carcinoma cells.
23807508 2013 p38?, A novel regulatory target of Pokemon in hepatic cells.
23727861 2013 Zbtb7a suppresses prostate cancer through repression of a Sox9-dependent pathway for cellular senescence bypass and tumor invasion.
23396304 2013 Role of LRF/Pokemon in lineage fate decisions.
23300578 2012 The silencing of Pokemon attenuates the proliferation of hepatocellular carcinoma cells in vitro and in vivo by inhibiting the PI3K/Akt pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23054188 2013 Homeostatic regulatory role of Pokemon in NF-?B signaling: stimulating both p65 and I?B? expression in human hepatocellular carcinoma cells.
22847180 2012 The oncogene LRF is a survival factor in chondrosarcoma and contributes to tumor malignancy and drug resistance.
22754333 2012 Pokemon silencing leads to Bim-mediated anoikis of human hepatoma cell QGY7703.
22447046 2012 Zbtb7 suppresses the expression of CDK2 and E2F4 in liver cancer cells: implications for the role of Zbtb7 in cell cycle regulation.
21985851 2011 Depletion of Pokemon gene inhibits hepatocellular carcinoma cell growth through inhibition of H-ras.
21771706 2011 Pokemon reduces Bcl-2 expression through NF-? Bp65: A possible mechanism of hepatocellular carcinoma.
21713761 2012 FBI-1 promotes cell proliferation and enhances resistance to chemotherapy of hepatocellular carcinoma in vitro and in vivo.
21640721 2011 Epidermal growth factor increases LRF/Pokemon expression in human prostate cancer cells.
21590684 2011 The transcription factor FBI-1/OCZF/LRF is expressed in osteoclasts and regulates RANKL-induced osteoclast formation in vitro and in vivo.
21392388 2011 Pro-oncogene Pokemon promotes breast cancer progression by upregulating survivin expression.
21251909 2011 Expression of leukemia/lymphoma related factor (LRF/Pokemon) in human benign prostate hyperplasia and prostate cancer.
21176152 2010 Overexpression of proto-oncogene FBI-1 activates membrane type 1-matrix metalloproteinase in association with adverse outcome in ovarian cancers.
20923760 2010 MicroRNA (miRNA)-mediated interaction between leukemia/lymphoma-related factor (LRF) and alternative splicing factor/splicing factor 2 (ASF/SF2) affects mouse embryonic fibroblast senescence and apoptosis.
20812024 2011 FBI-1 functions as a novel AR co-repressor in prostate cancer cells.
20394500 2010 ZBTB7 overexpression contributes to malignancy in breast cancer.
20336405 2010 Global mapping of ZBTB7A transcription factor binding sites in HepG2 cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19471103 2009 Eukaryotic translation initiator protein 1A isoform, CCS-3, enhances the transcriptional repression of p21CIP1 by proto-oncogene FBI-1 (Pokemon/ZBTB7A).
19444642 2010 Curcumin decreases the expression of Pokemon by suppressing the binding activity of the Sp1 protein in human lung cancer cells.
19244234 2009 Proto-oncogene FBI-1 represses transcription of p21CIP1 by inhibition of transcription activation by p53 and Sp1.
18801742 2008 Proto-oncogene FBI-1 (Pokemon/ZBTB7A) represses transcription of the tumor suppressor Rb gene via binding competition with Sp1 and recruitment of co-repressors.
18682402 2008 Proto-oncogene FBI-1 (Pokemon) and SREBP-1 synergistically activate transcription of fatty-acid synthase gene (FASN).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18550205 2008 Overexpression of Pokemon in non-small cell lung cancer and foreshowing tumor biological behavior as well as clinical results.
18482847 2008 Protein expression and purification of human Zbtb7A in Pichia pastoris via gene codon optimization and synthesis.
18368381 2008 Transcription factor FBI-1 acts as a dual regulator in adipogenesis by coordinated regulation of cyclin-A and E2F-4.
18355317 2008 Cloning and functional analysis of 5'-upstream region of the Pokemon gene.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17595526 2007 Regulation of pokemon 1 activity by sumoylation.
17189472 2007 Crystal structure of the BTB domain from the LRF/ZBTB7 transcriptional regulator.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17052694 2006 Structure of the POZ domain of human LRF, a master regulator of oncogenesis.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16341674 2005 Transcriptome analysis of human gastric cancer.
15917220 2005 FBI-1 enhances transcription of the nuclear factor-kappaB (NF-kappaB)-responsive E-selectin gene by nuclear localization of the p65 subunit of NF-kappaB.
15662416 2005 Role of the proto-oncogene Pokemon in cellular transformation and ARF repression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15337766 2004 Leukemia/lymphoma-related factor, a POZ domain-containing transcriptional repressor, interacts with histone deacetylase-1 and inhibits cartilage oligomeric matrix protein gene expression and chondrogenesis.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14701838 2004 Role of the POZ zinc finger transcription factor FBI-1 in human and murine adipogenesis.
12750370 2003 Flexible DNA binding of the BTB/POZ-domain protein FBI-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12004059 2002 POZ domain transcription factor, FBI-1, represses transcription of ADH5/FDH by interacting with the zinc finger and interfering with DNA binding activity of Sp1.
11907272 2002 FBI-1 can stimulate HIV-1 Tat activity and is targeted to a novel subnuclear domain that includes the Tat-P-TEFb-containing nuclear speckles.
9973611 1999 FBI-1, a factor that binds to the HIV-1 inducer of short transcripts (IST), is a POZ domain protein.
9927193 1999 Novel BTB/POZ domain zinc-finger protein, LRF, is a potential target of the LAZ-3/BCL-6 oncogene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.