Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.24
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 1.6e-06
ductal carcinoma in situ -1.200 1.1e-02
group 3 medulloblastoma -1.900 3.2e-05
invasive ductal carcinoma -1.700 7.2e-03
medulloblastoma, large-cell -2.500 8.4e-06
ovarian cancer -1.200 1.3e-07
primitive neuroectodermal tumor -1.400 4.6e-03

Gene RIF (1)

AA Sequence

MGRLNEQRLFQPDLCDVDLVLVPQRSVFPAHKGVLAAYSQFFHSLFTQNKQLQRVELSLEALAPGGLQQI      1 - 70
LNFIYTSKLLVNAANVHEVLSAASLLQMADIAASCQELLDARSLGPPGPGTVALAQPAASCTPAAPPYYC     71 - 140
DIKQEADTPGLPKIYAREGPDPYSVRVEDGAGTAGGTVPATIGPAQPFFKEEKEGGVEEAGGPPASLCKL    141 - 210
EGGEELEEELGGSGTYSRREQSQIIVEVNLNNQTLHVSTGPEGKPGAGPSPATVVLGREDGLQRHSDEEE    211 - 280
EDDEEEEEEEEEEEGGGSGREEEEEEEGGSQGEEEEEEEDGHSEQEEEEEEEEEEGPSEQDQESSEEEEG    281 - 350
EEGEAGGKQGPRGSRSSRADPPPHSHMATRSRENARRRGTPEPEEAGRRGGKRPKPPPGVASASARGPPA    351 - 420
TDGLGAKVKLEEKQHHPCQKCPRVFNNRWYLEKHMNVTHSRMQICDQCGKRFLLESELLLHRQTDCERNI    421 - 490
QCVTCGKAFKKLWSLHEHNKIVHGYAEKKFSCEICEKKFYTMAHVRKHMVAHTKDMPFTCETCGKSFKRS    491 - 560
MSLKVHSLQHSGEKPFRCENCNERFQYKYQLRSHMSIHIGHKQFMCQWCGKDFNMKQYFDEHMKTHTGEK    561 - 630
PYICEICGKSFTSRPNMKRHRRTHTGEKPYPCDVCGQRFRFSNMLKAHKEKCFRVSHTLAGDGVPAAPGL    631 - 700
PPTQPQAHALPLLPGLPQTLPPPPHLPPPPPLFPTTASPGGRMNANN                           701 - 747
//

Text Mined References (8)

PMID Year Title