Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.98
PubTator Score 17.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
Breast cancer 3578 4.9e-35
osteosarcoma 7950 5.5e-09
tuberculosis 2010 3.3e-05
hepatocellular carcinoma 547 1.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Granulomatous hepatitis 1 4.15 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.400 4.9e-35
hepatocellular carcinoma -1.300 1.5e-03
osteosarcoma -2.339 5.5e-09
tuberculosis 1.700 3.3e-05

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (9)

AA Sequence

MAETSPEPSGQLVVHSDAHSDTVLASFEDQRKKGFLCDITLIVENVHFRAHKALLAASSEYFSMMFAEEG      1 - 70
EIGQSIYMLEGMVADTFGILLEFIYTGYLHASEKSTEQILATAQFLKVYDLVKAYTDFQNNHSSPKPTTL     71 - 140
NTAGAPVVVISNKKNDPPKRKRGRPKKVNTLQEEKSELAAEEEIQLRVNNSVQNRQNFVVKGDSGVLNEQ    141 - 210
IAAKEKEESEPTCEPSREEEMPVEKDENYDPKTEDGQASQSRYSKRRIWRSVKLKDYKLVGDQEDHGSAK    211 - 280
RICGRRKRPGGPEARCKDCGKVFKYNHFLAIHQRSHTGERPFKCNECGKGFAQKHSLQVHTRMHTGERPY    281 - 350
TCTVCSKALTTKHSLLEHMSLHSGQKSFTCDQCGKYFSQNRQLKSHYRVHTGHSLPECKDCHRKFMDVSQ    351 - 420
LKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCGICGKSFSDSSAKRRHCILHTGKKPF    421 - 490
SCPECNLQFARLDNLKAHLKIHSKEKHASDASSISGSSNTEEVRNILQLQPYQLSTSGEQEIQLLVTDSV    491 - 560
HNINFMPGPSQGISIVTAESSQNMTADQAANLTLLTQQPEQLQNLILSAQQEQTEHIQSLNMIESQMGPS    561 - 630
QTEPVHVITLSKETLEHLHAHQEQTEELHLATSTSDPAQHLQLTQEPGPPPPTHHVPQPTPLGQEQS       631 - 697
//

Text Mined References (20)

PMID Year Title