Property Summary

NCBI Gene PubMed Count 51
PubMed Score 31.04
PubTator Score 42.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Cardiomyopathy, Dilated 47
Disease Target Count P-value
ovarian cancer 8491 2.8e-06
psoriasis 6685 4.1e-04
Disease Target Count Z-score Confidence
Cardiomyopathy 110 0.0 2.0
Disease Target Count Z-score Confidence
Congenital bile acid synthesis defect 13 3.522 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.400 4.1e-04
ovarian cancer 1.100 2.8e-06

 GWAS Trait (1)

Gene RIF (27)

PMID Text
26972249 This study presents the structure of the synthetic Miz-1 Zinc Finger 13 determined by 2D (1)H-(1)H NMR.
25558878 MIZ-1 can promote the proliferation of breast cancer cells through Wnt signaling.
24983942 results indicate that Miz-1 may be directed in vivo to the novel motif sequences we have identified, where it can recruit its specific binding partners to control gene expression and ultimately regulate cell fate
24618291 We demonstrate that Arnt is an interaction partner for Miz-1, and that Arnt has a functional role in the regulation of CDKN2B
24296348 The functional interaction of both proteins becomes apparent at oncogenic expression levels of MYC and association with MIZ-1 mediates both oncogenic functions of MYC as well as tumor-suppressive responses to oncogenic levels of MYC.
23570452 The ZBTB17 polymorphism rs10927875 appears to play a role in the susceptibility of the Han Chinese population to dilated cardiomyopathy .
22184250 The repression of TNF-alpha-induced JNK activation by Miz1 is de-repressed by its own site-specific ubiquitination and degradation.
22099967 study demonstrate that HPV-16 E7 forms a complex with Miz-1; These findings suggest that HPV-16 E7 protein can repress Miz-1-induced p21(Cip1) gene expression
21908575 NLRR3 is a direct target of MYCN, which associates with Miz-1 and negatively regulates NLRR3 expression.
20697356 Although the transient repression mediated by Miz-1/c-Myc is independent of de novo methylation, the stable repression by this complex is associated with CpG island methylation of the critical -295 to -95-bp region of the WIF-1 promoter
20493880 Miz1 BTB domain resembles a typical swapped BTB dimer, although it has a shorter N-terminus that is not able to form the interchain sheet
20308430 Binding of Arf disrupts the interaction of Miz1 with its coactivator, nucleophosmin, induces the sumoylation of Miz1, and facilitates the assembly of a heterochromatic complex that contains Myc and trimethylated H3K9 in addition to Miz1.
19901969 Miz-1 acts as a p53 suppressor by interfering with p53 DNA-binding ability
19815509 transcription factor Myc-interacting zinc-finger protein 1 (Miz1) selectively suppresses TNF-alpha-induced JNK1 activation and cell death independently.
19549844 These results identify an important function for BCL6 in facilitating apoptosis of germinal center B cells via suppression of BCL2, and suggest that blocking this pathway is critical for lymphomagenesis.
19164764 Gfi-1 does not directly bind to CDKN2B, but interacts with Miz-1 and, via Miz-1, is recruited to the core promoter of CDKN2B
19160485 The ribosomal protein L23 is a negative regulator of Miz1-dependent transactivation.
18923429 Miz1 and Myc affect the activity of the Atr checkpoint through their effect on TopBP1 chromatin association and stability.
17947461 MIZ-1 is a new favorable neuroblastoma gene, which may directly or indirectly regulate the expression of other favorable neuroblastoma genes
17880999 The crystal structure of the Miz-1 POZ domain show that the beta-sheet interface directs the tetramerisation of the Miz-1 POZ domain in solution.
17082179 repression of BCL2 transcription is the single essential consequence of targeting the MIZ-1 pathway during apoptosis induction, which explains a copperative interaction between c-MYC and BCL2
17050536 NDRG2 expression is repressed by Myc via Miz-1-dependent interaction with the NDRG2 core promoter
16537485 Miz-1 transcription factor was identified as an interactor of the SB transposase
16352593 Miz-1 targeting is essential for Myc-mediated apoptosis
16167342 replicative senescence-specific factors may block c-Myc inhibition of Miz-1 activation of hMad4 expression, and the continual presence of hMad4 protein may transcriptionally repress selected c-Myc target genes
14739298 Miz-1 has a role in inducing apoptosis along with MAGE-A4
12545156 repression of p21 promoter/reporters as well as the endogenous p21 gene by Myc depends on interaction with Miz-1. Expression of Miz-1 increases during hematopoietic differentiation and Miz-1 activates the p21 promoter under conditions of low Myc levels

AA Sequence

MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGL      1 - 70
GQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATEGGDKRAKEE     71 - 140
KVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADAPREPPPVELKPDPTSGMAAAEA    141 - 210
EAALSESSEQEMEVEPARKGEEEQKEQEEQEEEGAGPAEVKEEGSQLENGEAPEENENEESAGTDSGQEL    211 - 280
GSEARGLRSGTYGDRTESKAYGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACK    281 - 350
AHEKTHSPLKPYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQC    351 - 420
DYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLK    421 - 490
RHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVC    491 - 560
ERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLR    561 - 630
SHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEIS    631 - 700
KAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQ    701 - 770
AGELVFRPRDGAEGQPALAETSPTAPECPPPAE                                         771 - 803
//

Text Mined References (56)

PMID Year Title
26972249 2016 Solution structure of the 13th C2H2 Zinc Finger of Miz-1.
26766587 2016 The Interaction of Myc with Miz1 Defines Medulloblastoma Subgroup Identity.
25558878 2015 Myc-interacting zinc-finger protein 1 positively regulates Wnt signalling by protecting Dishevelled from Dapper1-mediated degradation.
25245946 2014 Two ZNF509 (ZBTB49) isoforms induce cell-cycle arrest by activating transcription of p21/CDKN1A and RB upon exposure to genotoxic stress.
24983942 2014 Miz-1 activates gene expression via a novel consensus DNA binding motif.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
24618291 2014 Regulation of CDKN2B expression by interaction of Arnt with Miz-1--a basis for functional integration between the HIF and Myc gene regulatory pathways.
24296348 2013 The role of MIZ-1 in MYC-dependent tumorigenesis.
23570452 2013 Polymorphism of ZBTB17 gene is associated with idiopathic dilated cardiomyopathy: a case control study in a Han Chinese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22184250 2012 Site-specific ubiquitination is required for relieving the transcription factor Miz1-mediated suppression on TNF-?-induced JNK activation and inflammation.
22099967 2012 The human papillomavirus type 16 E7 oncoprotein targets Myc-interacting zinc-finger protein-1.
21908575 2011 Expression of NLRR3 orphan receptor gene is negatively regulated by MYCN and Miz-1, and its downregulation is associated with unfavorable outcome in neuroblastoma.
21459883 2011 A genome-wide association study identifies two loci associated with heart failure due to dilated cardiomyopathy.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20697356 2010 Transcriptional regulation of Wnt inhibitory factor-1 by Miz-1/c-Myc.
20493880 2010 Insights into strand exchange in BTB domain dimers from the crystal structures of FAZF and Miz1.
20308430 2010 The Arf tumor suppressor protein inhibits Miz1 to suppress cell adhesion and induce apoptosis.
19901969 2010 ARF antagonizes the ability of Miz-1 to inhibit p53-mediated transactivation.
19815509 2009 Miz1 is a signal- and pathway-specific modulator or regulator (SMOR) that suppresses TNF-alpha-induced JNK1 activation.
19549844 2009 BCL6 suppression of BCL2 via Miz1 and its disruption in diffuse large B cell lymphoma.
19164764 2009 Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1.
19160485 2008 A ribosomal protein L23-nucleophosmin circuit coordinates Mizl function with cell growth.
18923429 2008 Miz1 and HectH9 regulate the stability of the checkpoint protein, TopBP1.
17947461 2007 De novo identification of MIZ-1 (ZBTB17) encoding a MYC-interacting zinc-finger protein as a new favorable neuroblastoma gene.
17880999 2007 A beta-sheet interaction interface directs the tetramerisation of the Miz-1 POZ domain.
17418410 2007 HIF-2alpha promotes hypoxic cell proliferation by enhancing c-myc transcriptional activity.
17082179 2007 BCL2 is a downstream effector of MIZ-1 essential for blocking c-MYC-induced apoptosis.
17050536 2006 The repression of human differentiation-related gene NDRG2 expression by Myc via Miz-1-dependent interaction with the NDRG2 core promoter.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16537485 2006 Sleeping Beauty transposase modulates cell-cycle progression through interaction with Miz-1.
16352593 2006 Targeting of Miz-1 is essential for Myc-mediated apoptosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16167342 2005 c-Myc creates an activation loop by transcriptionally repressing its own functional inhibitor, hMad4, in young fibroblasts, a loop lost in replicatively senescent fibroblasts.
16142238 2005 BCL6 interacts with the transcription factor Miz-1 to suppress the cyclin-dependent kinase inhibitor p21 and cell cycle arrest in germinal center B cells.
15752756 2005 Identification of novel CBP interacting proteins in embryonic orofacial tissue.
15616584 2005 Myc represses transcription through recruitment of DNA methyltransferase corepressor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15095404 2004 Induction of G1 cell cycle arrest and P15INK4b expression by ECRG1 through interaction with Miz-1.
14739298 2004 A cleaved form of MAGE-A4 binds to Miz-1 and induces apoptosis in human cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12840021 2003 Characterization of the murine Nramp1 promoter: requirements for transactivation by Miz-1.
12545156 2003 Myc represses differentiation-induced p21CIP1 expression via Miz-1-dependent interaction with the p21 core promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408820 2002 Negative regulation of the mammalian UV response by Myc through association with Miz-1.
12244100 2002 Host cell factor-1 interacts with and antagonizes transactivation by the cell cycle regulatory factor Miz-1.
11545736 2001 Transcription factor MIZ-1 is regulated via microtubule association.
11283613 2001 Repression of p15INK4b expression by Myc through association with Miz-1.
11068878 2000 Interaction of insulin-like growth factor binding protein-4, Miz-1, leptin, lipocalin-type prostaglandin D synthase, and granulin precursor with the N-terminal half of type III hexokinase.
9312026 1997 An alternative pathway for gene regulation by Myc.
9308237 1997 Association of Myc with the zinc-finger protein Miz-1 defines a novel pathway for gene regulation by Myc.
9256341 1997 Miz1, a novel zinc finger transcription factor that interacts with Msx2 and enhances its affinity for DNA.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7557990 1995 Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders.
1946370 1991 Characterization and mapping of human genes encoding zinc finger proteins.
1505991 1992 Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes.