Property Summary

NCBI Gene PubMed Count 16
PubMed Score 24.07
PubTator Score 17.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.3e-04
adult high grade glioma 3801 1.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Treacher Collins syndrome 27 3.055 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.100 1.6e-03
osteosarcoma -1.105 2.3e-04

Gene RIF (6)

AA Sequence

MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYFKKLFKKLEV      1 - 70
DSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQS     71 - 140
KSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEV    141 - 210
RKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQ    211 - 280
ACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKK    281 - 350
HERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTP    351 - 420
SAIQSETEQLQAAAMAAEAEQQLETIACS                                             421 - 449
//

Text Mined References (17)

PMID Year Title