Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.57
PubTator Score 8.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
Rheumatoid Arthritis 1.200 1.8e-02
gastric cancer -1.300 1.0e-03
hepatocellular carcinoma -1.700 9.1e-06
pancreatic cancer -1.300 5.1e-03
malignant mesothelioma 3.100 1.2e-08
astrocytoma 1.100 3.7e-14
oligodendroglioma 1.200 6.6e-12
osteosarcoma 1.411 7.9e-04
ependymoma 1.700 7.2e-08
glioblastoma 1.500 5.4e-04
medulloblastoma 2.300 8.0e-08
atypical teratoid / rhabdoid tumor 1.900 8.4e-06
medulloblastoma, large-cell 2.400 2.5e-04
primitive neuroectodermal tumor 1.900 3.2e-06
acute quadriplegic myopathy 1.443 3.3e-08
tuberculosis and treatment for 6 months 1.400 7.8e-04
intraductal papillary-mucinous adenoma (... -1.200 3.6e-02
intraductal papillary-mucinous carcinoma... -2.500 2.1e-04
intraductal papillary-mucinous neoplasm ... -2.400 9.8e-03
colon cancer -2.000 6.5e-03
sarcoidosis 1.300 7.6e-03
Breast cancer 3.200 3.0e-02
interstitial cystitis -1.500 5.3e-04
pediatric high grade glioma 1.500 7.2e-05
pancreatic carcinoma -1.300 5.1e-03
aldosterone-producing adenoma -1.268 2.9e-02
psoriasis -1.800 6.3e-14
acute myeloid leukemia 1.400 9.2e-03
ulcerative colitis -1.700 1.7e-02
ovarian cancer 1.100 2.4e-02
chronic rhinosinusitis -1.021 8.0e-03

Gene RIF (3)

PMID Text
23471840 Sp1, Sp3, and Sp4 and Sp-regulated genes were downregulated by curcuminoids in SW-480 and this was accompanied by suppression of microRNA-27a (miR-27a) and induction of ZBTB10, an mRNA target of miR-27a and a transcriptional repressor of Sp expression.
23254909 Collectively, these results indicated that stimulation of ovarian cancer cell VEGF, Cox2 and survivin expression by FSH involves the microRNA27a: ZBTB10-specificity protein pathway.
20382698 Study show that miR-27a indirectly regulates E2-responsiveness in MCF-7 cells through suppression of ZBTB10, thereby enhancing expression of ERalpha.

AA Sequence

MSFSEMNRRTLAFRGGGLVTASGGGSTNNNAGGEASAWPPQPQPRQPPPPAPPALQPPNGRGADEEVELE      1 - 70
GLEPQDLEASAGPAAGAAEEAKELLLPQDAGGPTSLGGGAGGPLLAERNRRTLAFRGGGGGGLGNNGSSR     71 - 140
GRPETSVWPLRHFNGRGPATVDLELDALEGKELMQDGASLSDSTEDEEEGASLGDGSGAEGGSCSSSRRS    141 - 210
GGDGGDEVEGSGVGAGEGETVQHFPLARPKSLMQKLQCSFQTSWLKDFPWLRYSKDTGLMSCGWCQKTPA    211 - 280
DGGSVDLPPVGHDELSRGTRNYKKTLLLRHHVSTEHKLHEANAQESEIPSEEGYCDFNSRPNENSYCYQL    281 - 350
LRQLNEQRKKGILCDVSIVVSGKIFKAHKNILVAGSRFFKTLYCFSNKESPNQNNTTHLDIAAVQGFSVI    351 - 420
LDFLYSGNLVLTSQNAIEVMTVASYLQMSEVVQTCRNFIKDALNISIKSEAPESVVVDYNNRKPVNRDGL    421 - 490
SSSRDQKIASFWATRNLTNLASNVKIENDGCNVDEGQIENYQMNDSSWVQDGSPEMAENESEGQTKVFIW    491 - 560
NNMGSQGIQETGKTRRKNQTTKRFIYNIPPNNETNLEDCSVMQPPVAYPEENTLLIKEEPDLDGALLSGP    561 - 630
DGDRNVNANLLAEAGTSQDGGDAGTSHDFKYGLMPGPSNDFKYGLIPGTSNDFKYGLIPGASNDFKYGLL    631 - 700
PESWPKQETWENGESSLIMNKLKCPHCSYVAKYRRTLKRHLLIHTGVRSFSCDICGKLFTRREHVKRHSL    701 - 770
VHKKDKKYKCMVCKKIFMLAASVGIRHGSRRYGVCVDCADKSQPGGQEGVDQGQDTEFPRDEEYEENEVG    771 - 840
EADEELVDDGEDQNDPSRWDESGEVCMSLDD                                           841 - 871
//

Text Mined References (22)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23471840 2013 The drug resistance suppression induced by curcuminoids in colon cancer SW-480 cells is mediated by reactive oxygen species-induced disruption of the microRNA-27a-ZBTB10-Sp axis.
23254909 2013 The microRNA-27a: ZBTB10-specificity protein pathway is involved in follicle stimulating hormone-induced VEGF, Cox2 and survivin expression in ovarian epithelial cancer cells.
22829776 2012 A genome-wide association meta-analysis of circulating sex hormone-binding globulin reveals multiple Loci implicated in sex steroid hormone regulation.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
22197932 2011 Meta-analysis of genome-wide association studies identifies three new risk loci for atopic dermatitis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20382698 2010 MicroRNA-27a Indirectly Regulates Estrogen Receptor {alpha} Expression and Hormone Responsiveness in MCF-7 Breast Cancer Cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.