Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.01
PubTator Score 2.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 1.500 5.4e-03
gastric cancer 1.300 5.1e-03
Multiple myeloma 1.918 5.1e-04
malignant mesothelioma -1.100 1.9e-05
psoriasis 1.700 3.9e-04
osteosarcoma 1.368 2.5e-04
glioblastoma 1.100 6.8e-03
Amyotrophic Lateral Sclerosis 1.158 7.7e-06
tuberculosis -2.000 5.6e-06
intraductal papillary-mucinous adenoma (... 1.200 9.9e-03
intraductal papillary-mucinous carcinoma... 1.200 8.7e-03
intraductal papillary-mucinous neoplasm ... 1.300 8.3e-03
lung cancer -1.100 1.0e-02
sarcoidosis 1.300 2.4e-02
sonic hedgehog group medulloblastoma 1.300 5.7e-04
progressive supranuclear palsy -1.100 8.5e-03
ovarian cancer -1.900 5.4e-07
Down syndrome 1.100 3.3e-03

Gene RIF (2)

PMID Text
24657165 ZBTB1 is required for localizing phospho-KAP-1 to chromatin and enhancing RAD18 accessibility during chromatin remodeling/DNA repair.
21706167 ZBTB1 protein may act as a transcription repressor in the activation of CREB and cAMP-mediated signal transduction pathways to mediate cellular functions.

AA Sequence

MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHSTAQLNLSNMKI      1 - 70
SAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVPDCLEDIQDADCSSSKCSSSASSKQNSKMIF     71 - 140
GVRMYEDTVARNGNEANRWCAEPSSTVNTPHNREADEESLQLGNFPEPLFDVCKKSSVSKLSTPKERVSR    141 - 210
RFGRSFTCDSCGFGFSCEKLLDEHVLTCTNRHLYQNTRSYHRIVDIRDGKDSNIKAEFGEKDSSKTFSAQ    211 - 280
TDKYRGDTSQAADDSASTTGSRKSSTVESEIASEEKSRAAERKRIIIKMEPEDIPTDELKDFNIIKVTDK    281 - 350
DCNESTDNDELEDEPEEPFYRYYVEEDVSIKKSGRKTLKPRMSVSADERGGLENMRPPNNSSPVQEDAEN    351 - 420
ASCELCGLTITEEDLSSHYLAKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNTEEKMDL    421 - 490
EENPDEQSEIRDMFVEMLDDFRDNHYQINSIQKKQLFKHSACPFRCPNCGQRFETENLVVEHMSSCLDQD    491 - 560
MFKSAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRERQLRLHNDMHKG    561 - 630
MARYVCSICDQGNFRKHDHVRHMISHLSAGETICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKD    631 - 700
MRSHYNAKHLKRT                                                             701 - 713
//

Text Mined References (19)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24657165 2014 Transcriptional repressor ZBTB1 promotes chromatin remodeling and translesion DNA synthesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22753936 2012 Transcription factor zinc finger and BTB domain 1 is essential for lymphocyte development.
21706167 2011 Novel human BTB/POZ domain-containing zinc finger protein ZBTB1 inhibits transcriptional activities of CRE.
20797634 2010 Site-specific identification of SUMO-2 targets in cells reveals an inverted SUMOylation motif and a hydrophobic cluster SUMOylation motif.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334068 2004 Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.