Property Summary

NCBI Gene PubMed Count 28
PubMed Score 196.85
PubTator Score 56.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 3.100 1.1e-04
osteosarcoma -3.090 3.7e-09
periodontitis 1.500 7.1e-22
tuberculosis 1.600 4.4e-06
interstitial cystitis 2.300 5.7e-04
ulcerative colitis 2.300 2.2e-07
psoriasis 2.200 2.6e-68

 MGI Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (17)

PMID Text
26116899 HIV-1 Vpr upregulates the gene expression of ZBP1 in human monocyte-derived dendritic cells
24080302 Our results show that HSV2 is detected by a plethora of PRRs including DAI protein which trigger cytokine secretion to protect the host.
23553627 DAI could function as a DNA sensor and a regulator in DNA-induced macrophage M2b polarization and lupus nephritis.
23283962 Collectively, these results demonstrate that DAI can suppress HSV-1 growth independent of DNA sensing through mechanisms involving suppression of viral genomes and regulation of ICP0.
22240322 The data of this study suggest that RNA-binding proteins can be used as a tool to identify the post-transcriptional regulation of gene expression in the establishment and function of neural circuits involved in addiction behaviors.
22114317 these data indicate that ZBP1 may function as an adapter to export the Ro/Y3 RNA complex from nuclei.
21471454 Solution structure of the Zbeta domain of human DNA-dependent activator of IFN-regulatory factors and its binding modes to B- and Z-DNAs.
21296080 hZbeta(DAI) binds to Z-DNA via an active-di B-Z transition mechanism.
20599623 These results suggest that activation of DAI might contribute to augment HIV-1 replication through DAI- NF-kappaB pathway.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19846511 identify ZBP1 as being essential for IRF3 activation and interferon beta expression triggered by HCMV, as well as being sufficient to enhance HCMV-stimulated beta interferon transcription and secretion.
19461076 These data suggest that repression of ZBP1 by blocking beta-catenin binding at the ZBP1 promoter deregulates its associated mRNAs, leading to the phenotypic changes of breast cancers.
19095800 binding 2 DAIs to 1 dsDNA brings about dimerization of DAI that might facilitate DNA-mediated innate immune activation.
18941233 DAI binds to and colocalizes with endogenous adaptor receptor-interacting protein kinase (RIP)1 at characteristic cytoplasmic granules.
18771559 In conclusion, intracellular bacteria and cytosolic poly(dA-dT) activate IFNbeta responses in different human cells without requiring human ZBP1.
16448869 Z-DNA binding activities of two Zalpha domains in the human ZBP1, hZalpha(ZBP1) and hZbeta(ZBP1)were characterized.
11842111 molecular cloning and structure analysis

AA Sequence

MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGG      1 - 70
TDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDV     71 - 140
NRDLYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNGPNSWISIANSEAIQIGH    141 - 210
GNIITRQTVSREDGSAGPRHLPSMAPGDSSTWGTLVDPWGPQDIHMEQSILRRVQLGHSNEMRLHGVPSE    211 - 280
GPAHIPPGSPPVSATAAGPEASFEARIPSPGTHPEGEAAQRIHMKSCFLEDATIGNSNKMSISPGVAGPG    281 - 350
GVAGSGEGEPGEDAGRRPADTQSRSHFPRDIGQPITPSHSKLTPKLETMTLGNRSHKAAEGSHYVDEASH    351 - 420
EGSWWGGGI                                                                 421 - 429
//

Text Mined References (28)

PMID Year Title
24080302 2014 Herpes simplex virus 2-induced activation in vaginal cells involves Toll-like receptors 2 and 9 and DNA sensors DAI and IFI16.
23553627 2013 DNA-dependent activator of interferon-regulatory factors (DAI) promotes lupus nephritis by activating the calcium pathway.
23283962 2013 DNA sensing-independent inhibition of herpes simplex virus 1 replication by DAI/ZBP1.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
22240322 2012 Transgenic expression of ZBP1 in neurons suppresses cocaine-associated conditioning.
22114317 2012 The zipcode-binding protein ZBP1 influences the subcellular location of the Ro 60-kDa autoantigen and the noncoding Y3 RNA.
21471454 2011 Solution structure of the Zbeta domain of human DNA-dependent activator of IFN-regulatory factors and its binding modes to B- and Z-DNAs.
21296080 2011 The Z? domain of human DAI binds to Z-DNA via a novel B-Z transition pathway.
20599623 2010 DNA-dependent activator of IFN-regulatory factors enhances the transcription of HIV-1 through NF-?B.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19846511 2010 Human cytomegalovirus induces the interferon response via the DNA sensor ZBP1.
19668339 2009 Hippocampal atrophy as a quantitative trait in a genome-wide association study identifying novel susceptibility genes for Alzheimer's disease.
19590578 2009 DAI/ZBP1 recruits RIP1 and RIP3 through RIP homotypic interaction motifs to activate NF-kappaB.
19461076 2009 Blocking beta-catenin binding to the ZBP1 promoter represses ZBP1 expression, leading to increased proliferation and migration of metastatic breast-cancer cells.
19158679 2009 An orthogonal proteomic-genomic screen identifies AIM2 as a cytoplasmic DNA sensor for the inflammasome.
19095800 2008 The crystal structure of the second Z-DNA binding domain of human DAI (ZBP1) in complex with Z-DNA reveals an unusual binding mode to Z-DNA.
18941233 2008 Receptor-interacting protein homotypic interaction motif-dependent control of NF-kappa B activation via the DNA-dependent activator of IFN regulatory factors.
18771559 2008 IFNbeta responses induced by intracellular bacteria or cytosolic DNA in different human cells do not require ZBP1 (DLM-1/DAI).
17618271 2007 DAI (DLM-1/ZBP1) is a cytosolic DNA sensor and an activator of innate immune response.
16448869 2006 Biochemical characterization and preliminary X-ray crystallographic study of the domains of human ZBP1 bound to left-handed Z-DNA.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11842111 2002 Complex regulation of the human gene for the Z-DNA binding protein DLM-1.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11524677 2001 Structure of the DLM-1-Z-DNA complex reveals a conserved family of Z-DNA-binding proteins.
10364558 1999 Crystal structure of the Zalpha domain of the human editing enzyme ADAR1 bound to left-handed Z-DNA.