Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.41
PubTator Score 1.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 5.9e-03
cystic fibrosis -1.094 1.5e-04
ependymoma 1.300 4.4e-07
glioblastoma 1.100 4.7e-03
group 3 medulloblastoma 1.300 1.5e-02
intraductal papillary-mucinous carcinoma... -1.300 2.6e-02
intraductal papillary-mucinous neoplasm ... -1.300 5.3e-03
invasive ductal carcinoma -1.100 2.0e-02
nasopharyngeal carcinoma 1.200 4.1e-04
osteosarcoma 1.179 9.2e-03
pancreatic ductal adenocarcinoma liver m... -1.111 2.3e-02

Gene RIF (5)

AA Sequence

MRSGEPACTMDQARGLDDAAARGGQCPGLGPAPTPTPPGRLGAPYSEAWGYFHLAPGRPGHPSGHWATCR      1 - 70
LCGEQVGRGPGFHAGTSALWRHLRSAHRRELESSGAGSSPPAAPCPPPPGPAAAPEGDWARLLEQMGALA     71 - 140
VRGSRRERELERRELAVEQGERALERRRRALQEEERAAAQARRELQAEREALQARLRDVSRREGALGWAP    141 - 210
AAPPPLKDDPEGDRDGCVITKVLL                                                  211 - 234
//

Text Mined References (14)

PMID Year Title