Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.24
PubTator Score 0.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.400 8.8e-07
esophageal adenocarcinoma -2.400 2.1e-02
cutaneous lupus erythematosus 2.300 1.1e-03
psoriasis 2.600 7.6e-04
Atopic dermatitis 1.200 1.0e-03
non-small cell lung cancer -2.322 1.2e-13
lung cancer -3.000 2.6e-05
pancreatic cancer 1.200 8.1e-04
interstitial cystitis 1.500 1.3e-02
cystic fibrosis 1.500 4.2e-03
lung adenocarcinoma -1.800 1.9e-07
spina bifida -2.665 2.2e-02
ovarian cancer 1.800 8.7e-03

AA Sequence

MMRREDEEEEGTMMKAKGDLEMKEEEEISETGELVGPFVSAMPTPMPHNKGTRFSEAWEYFHLAPARAGH      1 - 70
HPNQYATCRLCGRQVSRGPGVNVGTTALWKHLKSMHREELEKSGHGQAGQRQDPRPHGPQLPTGIEGNWG     71 - 140
RLLEQVGTMALWASQREKEVLRRERAVEWRERAVEKRERALEEVERAILEMKWKVRAEKEACQREKELPA    141 - 210
AVHPFHFV                                                                  211 - 218
//

Text Mined References (5)

PMID Year Title
23533661 2013 ZBED evolution: repeated utilization of DNA transposons as regulators of diverse host functions.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.