Property Summary

Ligand Count 20
NCBI Gene PubMed Count 276
PubMed Score 798.23
PubTator Score 1050.46

Knowledge Summary

Patent (114,997)

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 3.5e-02
interstitial cystitis 1.700 2.9e-03
osteosarcoma -1.330 2.2e-03
ovarian cancer -1.100 9.6e-04

PDB (13)

Gene RIF (194)

AA Sequence

MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYA      1 - 70
IAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQ     71 - 140
AIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYH    141 - 210
YLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHP    211 - 280
QRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFG    281 - 350
SVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG    351 - 420
PLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADD    421 - 490
SYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMEC    491 - 560
PPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGPPGSTQKAEAACA               561 - 619
//

Text Mined References (293)

PMID Year Title