Property Summary

NCBI Gene PubMed Count 239
PubMed Score 619.66
PubTator Score 453.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia 1.300 1.7e-02
acute quadriplegic myopathy 1.037 2.6e-03
adult high grade glioma -1.700 3.8e-06
Alzheimer's disease 1.100 2.9e-02
atypical teratoid / rhabdoid tumor -1.200 1.3e-05
diabetes mellitus 1.300 1.8e-02
fascioscapulohumeral muscular dystrophy 1.096 7.1e-05
glioblastoma -1.200 2.5e-06
juvenile dermatomyositis 1.140 1.3e-08
lung adenocarcinoma 1.708 8.9e-06
lung cancer 1.400 3.8e-03
medulloblastoma, large-cell 1.100 2.2e-03
Multiple myeloma 1.023 6.2e-04
osteosarcoma 2.566 2.7e-10
ovarian cancer -1.100 1.6e-06
pancreatic ductal adenocarcinoma liver m... -1.223 1.0e-02
Pick disease 1.700 1.1e-07
psoriasis 1.900 3.5e-05
tuberculosis and treatment for 6 months 1.100 2.3e-05
Waldenstrons macroglobulinemia 1.049 9.7e-03

Protein-protein Interaction (1)

Gene RIF (203)

AA Sequence

MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHGGGGGHGHAGH      1 - 70
HHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAG     71 - 140
GDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQV    141 - 210
QIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFA    211 - 280
RMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGE    281 - 350
KPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ          351 - 414
//

Text Mined References (256)

PMID Year Title