Property Summary

NCBI Gene PubMed Count 218
PubMed Score 593.97
PubTator Score 453.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.049 9.7e-03
Multiple myeloma 1.023 6.2e-04
psoriasis 1.900 3.5e-05
osteosarcoma 2.566 2.7e-10
atypical teratoid / rhabdoid tumor -1.600 1.2e-05
glioblastoma -1.700 1.4e-04
medulloblastoma, large-cell -1.200 1.0e-05
juvenile dermatomyositis 1.511 4.8e-12
acute quadriplegic myopathy 1.324 3.0e-05
fascioscapulohumeral muscular dystrophy 1.096 7.1e-05
primary pancreatic ductal adenocarcinoma 1.247 1.6e-03
tuberculosis and treatment for 6 months 1.100 2.3e-05
lung cancer 1.400 3.8e-03
diabetes mellitus -1.900 9.8e-03
adult high grade glioma -1.700 3.8e-06
lung adenocarcinoma 1.708 8.9e-06
Alzheimer's disease 1.100 2.9e-02
Pick disease 1.700 1.1e-07
acute myeloid leukemia 1.300 1.7e-02
ovarian cancer 2.200 1.1e-04

Gene RIF (186)

PMID Text
26910132 Significance of the pathogenic mutation T372R in the Yin Yang 1 protein interaction with DNA--thermodynamic studies: the mutation does not affect the secondary structure of either zinc fingers or the N-terminal fragment of the protein.
26800240 YY1 overexpression contributes to EZH2 recruitment for H3K27me3-mediated silencing of tumour-suppressive microRNAs, thereby activating NF-kappaB signalling in hepatocarcinogenesis.
26786659 YY1 regulates lung CCL4 transcription in pulmonary tuberculosis.
26618242 Study shows that YY1 regulates inflammatory responses in vascular endothelium through its binding to ANRIL.
26329601 These data demonstrate the crucial requirement for YY1 in lung morphogenesis.
26292095 IL-18 induced YY1 expression, which repressed FXR and MRP2 expression in HepG2 cells.
26198631 Data show that YY1 transcription factor (YY1) is tyrosine-phosphorylated by Src family kinases, leading to down-regulation of its activity.
26104682 Results identify a novel YY1 ~ miR-9 ~ RYBP axis involved in melanoma tumorigenesis and reinforce the idea that regulatory circuitries involving miRNAs and TFs are prevalent mechanisms.
25963536 The results of our study indicate that YY1 belongs to the family of intrinsically disordered proteins, which exist natively in a partially unfolded conformation.
25954903 Rescue experiments indicated that the suppressive effect of miR-34a on invasion and migration was mediated by activating YY1 expression.
25935483 YY1 regulates, in a sex-specific manner, Mena expression in heart failure
25885449 YY1 is a transcription repressor of FEN1 regulating FEN1 levels in response to DNA damaging agents.
25787250 YY1(T372R) mutations are neomorphic, resulting in constitutive activation of cAMP and Ca(2+) signaling pathways involved in insulin secretion in insulin-producing adenomas
25775215 Results demonstrate that YY1 is a critical effecter in IL-13-induced fibroblast differentiation: increasing YY1 enhances it whereas decreasing YY1 reduces it.
25772619 results suggest that YY1 up-regulates UBIAD1 expression and UBIAD1 conversion activity through the UBIAD1 promoter
25764217 Transcription factor YY1 is critically involved in the chromatin remodeling and chromosomal interactions at the Th2 cytokine locus.
25763608 The somatic Thr372Arg YY1 mutation is a relevant finding in female patients with sporadic insulinomas.
25731772 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
25727947 These findings imply that the T allele significantly suppresses PSCA expression in vivo by recruiting YY1 to its promoter, which eventually predisposes gastric epithelial cells to GC development
25698133 YY1 is overexpressed in differentiated thyroid cancer, and more frequently overexpressed in the papillary carcinoma subtype.
25644713 YY1 is necessary to maintain the steady-state level of VEGFA expression while its silencing increases VEGFA mRNA half-life at 4 h and impairs the maturation of miRNA 200b/c.
25427980 These data show that hepatitis B virus proteins repress DGCR8 promoter activity by upregulating the expression of transcription factor YY1.
25209548 YY1 is the first autosomal activating factor involved in a fundamental and conserved pathway of Xist regulation that ensures the asymmetric transcriptional upregulation of the master regulator of X-chromosome inactivation.
24991827 YY1 regulated SQSTM1 expression through the epigenetic modulation of the transcription of MIR372 (microRNA 372) which was found to target SQSTM1 directly.
24990942 these findings suggest that YY1-RuvBL1-RuvBL2 complexes could contribute to functions beyond transcription, and we show that YY1 and the ATPase activity of RuvBL2 are required for RAD51 foci formation during homologous recombination.
24970812 Data indicate that the 3'-untranslated region (3'-UTR) of transcription factor Yin Yang 1 (YY1) mRNA was the target of microRNA-34 (miR-34) family consisting of miR-34a, miR-34b, and miR-34c.
24970600 Findings revealed that the expression of YY1 is upregulated in Multiple myeloma, its higher nuclear localization is associated with disease progression.
24884523 YY1 suppresses invasion and metastasis of pancreatic ductal adenocarcinoma by downregulating MMP10 in a MUC4/ErbB2/p38/MEF2C-dependent mechanism.
24862326 Taken together, these results demonstrate that HIV-1 Tat protein suppresses CX3CR1 expression in microglia via NF-kappaB-YY1 pathway and attenuates CX3CL1-induced functional response of microglia.
24862326 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
24803334 These results suggest a novel regulatory mechanism for YY1 function by Smurf2.
24674326 data demonstrated that YY1 contributes to gastric carcinogenesis in gastric cancer. In early stage GACs YY1 might serve as a poor prognostic marker and possibly as a potential therapeutic target
24554339 Subsequently, we examined in a subset of the study the expression in blood of two genes regulating mitochondrial biogenesis, YY1 and PGC-1alpha. We found a positive association of YY1 expression and mtDNA content in controls.
24508259 Data show that knockdown of Yin Yang 1 (YY1) releases the survivin promoter from the observed repression and leads to a 3- to 5-fold increase in promoter activity above basal levels.
24481728 The expression of miR-34a in renal cell carcinoma cells displayed an inverse correlation with YY1, but a positive correlation with C/EBPalpha
24418559 The cellular factor YY1 played role in varicella-zoster virus replication through the mediation of IE62 activation of viral gene expression.
24369345 findings define a novel mechanism of Smad7 and YY1 to antagonize TGF-beta signaling
24326773 T372R mutation alters the expression of YY1 target genes in pancreatic beta-cells of insulinomas.
24116200 Study identified a novel binding site for YY1 on the HIV-1 LTR, 120 nucleotides upstream of the transcription start site; YY1 can bind to this site in vitro and in vivo and binding to the LTR is dissociated upon T cell activation.
24105472 NLRP7 affects trophoblast lineage differentiation, binds to overexpressed YY1 and alters CpG methylation.
24026176 Little change was observed in SNCA expression levels; however, RP11-115D19.1 expression was prominently stimulated by YY1.
23919806 The expression of YY1 significantly correlates with that of HO-1 in esophageal squamous cell carcinoma tissues.
23874387 Depletion of YY1 or RelA almost completely impaired the colony forming ability of multiple myeloma(MM) progenitor cells suggesting that both RelA and YY1 are essential for the survival and growth of MM progenitor cells.
23813057 Transient YY1 overexpression significantly inhibited MUC4 promoter activity and endogenous MUC4 protein expression.
23803414 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
23776572 Yin Yang 1 intronic binding sequences and splicing elicit intron-mediated enhancement of ubiquitin C gene expression.
23757039 The results confirm association of YY1 and PLK1 with outcome in follicular lymphoma and suggest coexpression at the centrosome.
23630070 This is the first study to detect a specific fusion gene in mesothelioma (the reason how frequent the EWSR1-YY1 fusion is remains uncertain) and also the first time that direct involvement of YY1 in oncogenesis has been demonstrated
23560079 USF2 functionally interacts with YY1 blocking its inhibitory activity, in favor of CEBPB transactivation.
23539139 HCFC1 is a common component of active human CpG-island promoters and coincides with ZNF143, THAP11, YY1, and GABP transcription factor occupancy.
23523134 Cellular transcription factors Sp1, Sp3 and YY1 bind to the varicella-zoster virus ORF3 promoter, and mutation of their binding sites inhibited ORF3 gene expression.
23403125 The identification of the general transcription factor Yin Yang 1 (YY1) as a novel and specific binding partner of S6K2, but not S6K1.
23348961 YY1 expression was upregulated in obese mice and non-alcoholic fatty liver disease patients. Overexpression of YY1 in healthy mice promoted hepatosteatosis under high-fat dietary conditions. YY1 suppressed farnesoid X receptor expression.
23328582 findings unraveled a novel mechanism by which YY1 inhibition disrupts hypoxia-stimulated HIF-1alpha stabilization in a p53-independent manner
23226345 YY1 is a novel substrate of the Aurora B kinase both in vitro and in vivo
23208495 YY1 promotes colon cancer growth through inhibiting p53 and promoting Wnt signaling pathways and serves as an independent prognostic biomarker for colorecatl cancer patients.
22944692 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
22929025 Knockdown of YY1 led to a significant reduction in GDF5 expression, supporting YY1 as a GDF5 activator.
22907428 Our results therefore establish a novel miR-193a-5p-YY1-APC axis, which contributes to endometrioid endometrial carcinoma
22776217 propose that, in the cell, YY1 may achieve higher specificity by associating with co-regulators or as a part of multi-subunit complexes
22536409 Two direct YY1 binding sites within the PSCA promoter, an inhibitory upstream site and a downstream site, proximal to the androgen-responsive element, which stimulated PSCA promoter activity.
22467534 Binding of YY1 at the -31C Site of IL1B Promoter
22440256 Yin Yang 1 plays an essential role in breast cancer and negatively regulates p27.
22391813 Study demonstrated that YY1 could promote hepatocellular carcinogenesis and inhibit cellular differentiation through the downregulation of CEBPA expression.
22292071 Pregnane X receptor and yin yang 1 contribute to the differential tissue expression and induction of CYP3A5 and CYP3A4.
22267549 Findings indicate that galiximab inhibits the NF-kappaB/Snail/YY1/Bcl-XL circuit that regulates drug resistance in B-cell lymphoma and in combination with cytotoxic drugs results in apoptosis.
22262839 Data show that bilirubin interacts with the Raf/ERK/MAPK pathway, effect on cyclin D1 and Raf content, altered retinoblastoma protein profile of hypophosphorylation, calcium influx, and YY1 proteolysis.
22253417 analysis of angiotensin II-dependent transcriptional activation of human steroidogenic acute regulatory protein gene by a 25-kDa cAMP-responsive element modulator protein isoform and Yin Yang 1
22248059 expression, function, and role of YY1 in the pathogenesis of hematologic malignancies are summarized briefly herein. Data are represented for B non-Hodgkin lymphoma, AIDS-related lymphoma, multiple myeloma, and children's acute lymphocytic leukemia
22248058 studies are reviewed to give an overview of the increasingly recognized importance of YY1 in human tumorigenesis
22248057 article summarizes all critical aspects that are (or will be) relevant for a better understanding of YY1- and/or YY2-mediated cellular control mechanisms
22248056 discuss the multiple roles and mechanisms of YY1 in the regulation of gene expression, its genetic factor functions, epigenetic regulatory activity, and its role as a redox sensor in the context of malignant neoplastic diseases
22248055 propose YY1 as a potential novel prognostic biomarker for EMT and a therapeutic target for both the prevention of metastasis and the reversal of resistance
22248054 review highlights the unexplored mechanism through which fluctuations in YY1 protein levels alter the transcriptional status of imprinted genes containing clustered YY1 binding sites, which potentially could affect cancer development and/or progression
22248053 Although there is not a complete consensus about the role of YY1 in cancers based on its activities of regulating oncogene and tumor suppressor expression, most of the currently available evidence supports a role of YY1 in tumorigenesis
22184066 identify serine 118 in the transactivation domain of YY1 as the site of CK2alpha phosphorylation, proximal to a caspase 7 cleavage site
22169291 Transfection of DLL4 into K562 cells increased the protein expression levels of transcription factor YY1 and proto-oncogene c-Myc, which slowed cell proliferation and increased apoptosis.
22065573 Nuclear factor kappaB subunits RelB and cRel negatively regulate Toll-like receptor 3-mediated beta-interferon production via induction of transcriptional repressor protein YY1.
21839814 The identification of the functional role of YY1 in the transcriptional control of the human POSTN gene adds new insights in the studies focused on gene expression in normal and transformed cells.
21795679 Altered binding of SP1 and YY1 to the promoter correlated with cellular UDP-N-acetylhexosamines content and inhibition of HAS2 expression.
21792014 results demonstrated that the expression of YY1 is upregulated in cervical carcinomas and that YY1 plays a critical role in the progression of HPV-positive cervical cancer
21666725 YY1 is a key regulator of BRCA1 expression and may be causally linked to the molecular etiology of human breast cancer.
21565439 YY1 expression is associated with smaller quadriceps fibre CSA in COPD and nuclear localisation of YY1 was found in muscle of patients but not controls. Regulation of YY1 appears altered in COPD and may be implicated in COPD-related muscle atrophy
21454521 Sin3a, HDAC1, and YY1 are co-factors for Gon4l and that Gon4l may function as a platform for the assembly of complexes that regulate gene expression.
21385102 results do not support the hypothesis of YY-1 involvement in idiopathic pulmonary fibrosis; however, similar expression of YY-1 gene in two biological samples cannot exclude a possible role of this polymorphic gene in the pathway of IPF
21378158 the MYO7A SNP differentially regulates the binding of the YY1 transcription factor with the T(-4128) allele creating an YY1 binding site
21376359 These results imply that YY1 is involved in the regulation of Kaposi's sarcoma-associated herpesvirus reactivation.
21345358 HBV could promote HLJ1 expression by up-regulating the transcription factor YY1.
21332389 The frequent alteration in the YY1-RKIP balance might represent a marker of malignant progression and be exploited for therapeutic interventions in HCC.
21326896 Studies indicate that elevated Yin Yang 1 (YY1) expression correlates with higher morphologic grades or malignant histological phenotypes in prostate cancer.
21282644 Studies in mouse suggest Yy1 may be an important regulator of differentiation state-specific genes in germinal-center B-cell.
21253604 Plk1 directly phosphorylates YY1 in vitro and in vivo at threonine 39 in the activation domain, and this phosphorylation is cell cycle regulated and peaks at G2/M.
21182263 Demonstrated that miR-34a directly targets YY1 through a miR-34a-binding site within the 3' UTR of YY1 using a luciferase reporter system.
21057508 YY1 is an important activator of peripheral myelination and neuregulin signaling.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20805357 HCF-1 interacts with the middle region of YY1 encompassing the glycine-lysine-rich domain and is essential for the formation of a ternary complex with YY1 and BAP1 in vivo.
20686494 YY1 may have a role in maintenance of the undifferentiated phenotype of keratinocytes in the basal epidermal layer, and reduction of YY1 in the suprabasal layers may allow keratinocytes to differentiate and move toward the upper layers of the epidermis
20666933 increased YY1 levels and DNA methylation percentage in the 5' untranslated region of Adenosine A(2A) receptors were found in the cerebellum with respect to the putamen of human brains
20663886 Inhibition of YY1 in combination with forced expression of p300 and Sp3 restored the expression of ChM-I in cells with a hypomethylated promoter region, but not in cells with hypermethylation.
20660740 YY1 forms an active complex with HIF-1alpha at VEGF gene promoters and increases VEGF transcription
20519390 The results of coimmunoprecipitation and in vitro pulldown assays revealed that Yin Yang 1 interacted with the catalytic core and C-terminal domains of human immunodeficiency virus type 1 integrase.
20519390 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
20504995 Data show that MeCP2 cooperates with YY1 in repressing the ANT1 gene encoding a mitochondrial adenine nucleotide translocase.
20431063 NFIB/X and NFY repressors contribute differentially to organ-specific regulation of the VWF promoter.
20430007 diverse binding affinities of YY1 and its interacting partners to iNOS -1026C/A resulted in differential promoter activity, and potent inhibition of iNOS expression by YY1/AP-1 complex with -1026C may contribute to an enhanced risk for hypertension.
20237276 BMP2 is both negatively and positively regulated by Smad4 and YY1 bound to a promoter region in cerebral cortex neurons.
20233728 Cis-acting genetic variation at an E2F1/YY1 response site and putative p53 site is associated with altered allele-specific expression of ERCC5 (XPG) transcript in normal human bronchial epithelium.
20215434 short hairpin loop inhibitory RNAs for human YY1 and its homolog YY2 caused significant changes in both shared and distinguishable gene sets in human cells.
20138641 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
20105288 The transcriptional changes of YY1 target genes after the CoCl2 exposure indicate an induction or enrichment of the YY1 protein but it remains unclear, whether the substitution of zinc ions by Co2+ is responsible for that.
20081375 These results suggest a dual role of YY1 in cancer development, either through overexpression or under-expression, depending on the tumor type.
20081364 These data suggest that YY1 is involved in B cells transformation which gives rise to high-grade lymphomas through a dysregulation in the normal development of B cells affecting cell cycle and cellular motility.
20025767 Nuclear expression of YY1 was detected in 33% of breast cancer cases investigated.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19793915 These results demonstrate a novel mechanism for the inactivation of YY1 through phosphorylation of its DNA-binding domain.
19720140 There is a consensus YY1 binding site in the GDAP1 core promoter. Overexpression of YY1 activated the GDAP1 promoter in a reporter gene system as well as increased the level of endogenous mRNA.
19712462 YY1 is autoregulated through its own DNA-binding sites.
19685047 FcepsilonRIalpha gene -18483A>C polymorphism affects transcriptional activity through YY1 binding.
19575798 Two key transcription factors, NRF-2 and YY-1, were further identified to coordinately participate in driving gene expressions of PREPL-C2ORF34 genes pairin an additive manner.
19566924 reduction of YY1 expression in breast cancer cells could contribute to the acquisition of an invasive phenotype through increased cell migration as well as by reduced expression of HP1alpha
19553391 In contrast to other viral and cellular promoters, where YY1 is thought to function as a positive transcription-'initiator' factor, HPV-16 P97 transcription is downregulated by YY1 from a critical motif overlapping the transcription start site.
19483472 PTEN induces HIF-2alpha transcriptional activity by inhibiting expression of Yin Yang 1 (YY1), which acts as a novel corepressor of HIF-2alpha.
19360355 YY1 mRNA and protein stability are important regulatory mechanisms of YY1 expression in colon cancer.
19297611 These results indicate that YY1 functions to negatively regulate these vaccinia virus promoters by binding to their initiator elements.
19235591 a positive correlation between the autocrine expression of YY1 and TGF-beta 1, IGF-1 and FGF-2, known to be involved in the progression of gliomas and meningiomas
19164126 two CpG islands adjacent to the Sp1 and YY1 elements in the promoter region were methylated, which together with reduced Sp1, contributed to the failure of interaction of Sp1 with YY1 and their binding to the elements, leading to silencing of the MOR gene
19129193 Identification of adjacent binding sites for the YY1 and E4BP4 transcription factors in the PrP (Prion) gene promoter.
19034670 HIV-1 induces OTK18 expression through a YY1-mediated manner in human macrophages
18950698 The DNA-binding sites of YY1 are longer than the known motif of YY1.
18753137 YY1 physically interacts with SUZ12 and can act as a mediator to recruit the polycomb group proteins and DNA methyltransferases to participate in the CEBPD gene silencing process
18558095 YY1, HDAC3 and HDAC4 restrained cell senescence by repressing p16(INK4a) expression through an epigenetic modification of histones
18542060 C-terminal region of p300 provides corepressor function and facilitates the recruitment of p300 and HDAC3 to the YY1-binding site and represses the c-Myc promoter.
18488713 Silencing of YY1 downregulates RIZ1 promoter in human osteosarcoma.
18485096 This review focuses on the function of YY1 in the nervous system including its role in neural development, neuronal function, developmental myelination, and neurological disease.
18480431 These results reveal that HDAg interacts with cellular transcription factor YY1 and its associated acetyltransferases CBP and p300 in a large nuclear complex, which in turn modulates the replication of HDV RNA.
18424742 proteasome inhibitor NPI-0052 inhibits the transcription repressor Yin Yang 1 (YY1) which regulates TRAIL resistance and negatively regulates DR5 transcription.
18423564 YY-1 expression was higher in airway biopsy specimens from asthmatic compared with control subjects
18391986 acute loss of p53 in normal HKc induces EGFR expression by a mechanism that involves YY1 and Sp1 and does not require p53 binding to the EGFR promoter
18389627 Transcription factor YY1 participates in activation transcription of the human ribosomal protein L11 gene
18339860 YY1 and VEGF/CXCR4 seem to intervene in the pathogenesis of the malignant phenotype of osteosarcoma by acting on cell invasiveness and metastasis growth.
17990281 the cooperative interaction of Sp1 and YY1 transcription factors is the critical event triggering the initiation of transcription of the MOR gene in lymphocytes
17980704 YY1 and E2F1 have synergistic effect on p73 promoter activity
17973241 study identified the major CD30 gene promoter microsatellite binding activity as the transcription factor Yin Yang 1
17973082 These results suggest that YY1 might be a negative regulator of PPARdelta gene expression through its direct interaction with the PPARdelta promoter.
17925399 the transcription factor YY1 binds to and recruits HDAC3 to the lanosterol synthase promoter.
17721549 Binding of YY1 to its DNA sites in target genes requires INO80, suggesting that YY1 uses the INO80 complex not only to activate transcription but also to gain access to target promoters
17556661 a new role for YY1 as both an inducer of p53 instability in smooth muscle cells, and an indirect repressor of p21WAF1/Cip1 transcription, p21WAF1/Cip1-cdk4-cyclin D1 assembly and intimal thickening.
17549406 Our findings provide for the first time evidence for the implication of YY1 in uterine cervix carcinogenesis.
17434929 Transcription factor Ying Yang 1 (YY1) indirectly regulates the C promoter-binding factor 1 (CBF1)-dependent Notch1 signaling via direct interaction with the Notch1 receptor.
17353273 Results report that Yin Yang 1 protein can be sumoylated both in vivo and in vitro by PIASy, a SUMO E3 ligase.
17192956 Schizophrenia-associated SNP in the Syt11 5'UTR region, where the potent transcription factor YY1 can bind, affects the transcriptional activity of Syt11.
16963455 YY1 represses homeo box A11-dependent transcription via interactions with the homeo box proteins and Histone Deacetylase recruitment
16954376 We discuss here the capacity of YY1 to either repress (through histone deacetylase recruitment) or activate (through CBP recruitment) IFN-beta gene expression according to the occupancy of either only its -90 site or both its -122 and -90 sites.
16918502 Depletion of E2F1 prevented prohibitin from repressing the YY1 promoter.
16769183 YY1 accelerates the binding of SNAP(c) to the proximal sequence element, its target within snRNA promoters.
16314465 Actin polymerization controls subcellular YY1 localization, which contributes to vascular smooth muscle proliferation and differentiation in normal pulmonary artery development.
16260628 the novel factor YY2 antagonizes the negative actions exerted by YY1
16170350 HCV core can recruit B23 and p300 to relieve the repression effect of YY1 on B23 promoter activity
16143308 Altogether, these findings reveal that NO inhibits YY1 DNA-binding activity through S-nitrosation and consequently results in upregulation of Fas expression and tumor cell sensitization to Fas-induced apoptosis.
15955096 Sp1 and YY1 transactivate human ATP2C1 promoter via cis-enhancing elements and that incomplete upregulation of ATP2C1 transcription contributes to keratinocyte-specific pathogenesis of Hailey-Hailey disease.
15942652 YY1 may play a role in prostate cancer development; however, decreased YY1 may give metastatic cells a survival advantage
15870067 YY1 cooperates with AP-2 to stimulate ERBB2 promoter activity through the AP-2 binding sites
15831475 YY1 is involved in a positive feedback loop during apoptosis.
15805285 CHK down-regulates CXCR4 through the YY1 transcription factor, leading to decreased CXCR4-mediated breast cancer cell motility and migration.
15782117 Overexpression of YY1 in lung carcinoma cell line cells can increase HLJ1 expression and reduce cell invasive capability
15586248 YY1 plays an important role in epidermal differentiation by negatively regulating the human involucrin gene promoter.
15295102 YY1 regulates the transcriptional activity, acetylation, ubiquitination, and stability of p53 by inhibiting its interaction with the coactivator p300 and by enhancing its interaction with the negative regulator Mdm2.
15291746 results designate YY1 as the factor responsible for the intron 1-mediated boost of the HSD3B2 gene basal promoter activity
15210108 YY1 is a negative regulator of p53.
15153544 transcription factors GATA4 and YY1 are involved in the regulation of FcgammaRIIb expression, and that the expression variants of FcgammaRIIb lead to altered cell signaling, which may contribute to autoimmune pathogenesis in humans.
15084399 the YY1 factor is translocted to the cytoplasm of vaccinia virus infected macrophages
12913000 The ankyrin domain of Notch1 receptor (N1IC) and zinc finger domains of YY1 were essential for the association of N1IC and YY1, which were both present in a large complex of the nucleus to suppress activity transactivated by Notch signaling
12808092 YY1 represses Smad transcriptional activities in a gene-specific manner and thus regulates cell differentiation induced by TGF-beta superfamily pathways
12805085 individuals bearing haplotypic variants of the MCP-4 core promoter that avidly bind the transcription factor YY-1 had higher plasma levels of MCP-4 than did individuals with variants with lower binding avidity
12788099 The interaction domains between YY1 and SAP30 were mapped to the C-terminal segment of YY1 (295-414) and the C-terminal 91 amino acid region of SAP30.
12754214 YY1 is a negative regulator of alpha-myosin heavy chain gene expression in human heart failure.
12588874 YY1-regulated transcription is very likely connected to the pathway of glucose metabolism that culminates in the O-GlcNAcylation on YY1, changing its function in transcription
12571248 This transcription factor down-regulates expression of CCR5, a major coreceptor for HIV-1.
12483538 discovery as regulatory determinant of DEK expression and consistency with the well-documented roles of this factor in cellular proliferation and transformation
12411495 interaction with E2F provides mechanism for specificity of E2F function
12393438 Some AML patients showed significantly elevated YY1 transcript levels in bone marrow cells, which together with data presented on mice suggests involvement of abnormal YY1 expression in pathogenesis of human AML
11940654 Counterregulation of chromatin deacetylation and histone deacetylase occupancy at the integrated promoter of human immunodeficiency virus type 1 (HIV-1) by the HIV-1 repressor YY1 and HIV-1 activator Tat.
11940654 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
10888618 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
9371597 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
8289393 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter

AA Sequence

MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHGGGGGHGHAGH      1 - 70
HHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAG     71 - 140
GDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQV    141 - 210
QIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFA    211 - 280
RMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGE    281 - 350
KPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ          351 - 414
//

Text Mined References (234)

PMID Year Title
26910132 2016 Significance of the pathogenic mutation T372R in the Yin Yang 1 protein interaction with DNA--thermodynamic studies.
26800240 2016 Yin Yang 1-mediated epigenetic silencing of tumour-suppressive microRNAs activates nuclear factor-?B in hepatocellular carcinoma.
26786659 2016 A novel role of Yin-Yang-1 in pulmonary tuberculosis through the regulation of the chemokine CCL4.
26618242 2016 Long non-coding RNA ANRIL regulates inflammatory responses as a novel component of NF-?B pathway.
26329601 2015 Epithelial inactivation of Yy1 abrogates lung branching morphogenesis.
26292095 2015 Interleukin-18 Down-Regulates Multidrug Resistance-Associated Protein 2 Expression through Farnesoid X Receptor Associated with Nuclear Factor Kappa B and Yin Yang 1 in Human Hepatoma HepG2 Cells.
26198631 2015 Regulation of Yin Yang 1 by Tyrosine Phosphorylation.
26104682 2015 YY1 regulates melanoma tumorigenesis through a miR-9?~?RYBP axis.
25963536 2015 Intrinsic disorder of human Yin Yang 1 protein.
25954903 2015 miR-34a inhibits the migration and invasion of esophageal squamous cell carcinoma by targeting Yin Yang-1.
25935483 2015 Transgenic over-expression of YY1 induces pathologic cardiac hypertrophy in a sex-specific manner.
25885449 2015 YY1 suppresses FEN1 over-expression and drug resistance in breast cancer.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25775215 2015 IL-13 induces YY1 through the AKT pathway in lung fibroblasts.
25772619 2015 YY1 positively regulates human UBIAD1 expression.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25764217 2014 Role of YY1 in long-range chromosomal interactions regulating Th2 cytokine expression.
25763608 2015 Frequency and clinical correlates of somatic Ying Yang 1 mutations in sporadic insulinomas.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25727947 2015 rs2294008T, a risk allele for gastric and gallbladder cancers, suppresses the PSCA promoter by recruiting the transcription factor YY1.
25698133 2015 Expression of YY1 in Differentiated Thyroid Cancer.
25644713 2015 Polycomb YY1 is a critical interface between epigenetic code and miRNA machinery after exposure to hypoxia in malignancy.
25427980 2015 Regulation of the microRNA processor DGCR8 by hepatitis B virus proteins via the transcription factor YY1.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25209548 2014 A prominent and conserved role for YY1 in Xist transcriptional activation.
24991827 2014 YY1-MIR372-SQSTM1 regulatory axis in autophagy.
24990942 2014 Structure of Yin Yang 1 oligomers that cooperate with RuvBL1-RuvBL2 ATPases.
24970812 2014 Yin Yang 1 is a target of microRNA-34 family and contributes to gastric carcinogenesis.
24970600 2014 Overexpression of Yin Yang 1 in bone marrow-derived human multiple myeloma and its clinical significance.
24884523 2014 Yin Yang-1 suppresses invasion and metastasis of pancreatic ductal adenocarcinoma by downregulating MMP10 in a MUC4/ErbB2/p38/MEF2C-dependent mechanism.
24862326 2014 HIV-1 Tat disrupts CX3CL1-CX3CR1 axis in microglia via the NF-?BYY1 pathway.
24803334 2014 Smurf2 regulates the degradation of YY1.
24674326 2014 Yin Yang 1 contributes to gastric carcinogenesis and its nuclear expression correlates with shorter survival in patients with early stage gastric adenocarcinoma.
24554339 2014 Low mitochondrial DNA content associates with familial longevity: the Leiden Longevity Study.
24508259 2014 Yin Yang 1 regulates the transcriptional repression of Survivin.
24481728 2014 YY1-C/EBP?-miR34a regulatory circuitry is involved in renal cell carcinoma progression.
24418559 2014 Cellular transcription factor YY1 mediates the varicella-zoster virus (VZV) IE62 transcriptional activation.
24369345 2014 Yin Yang 1 (YY1) synergizes with Smad7 to inhibit TGF-? signaling in the nucleus.
24326773 2013 Whole exome sequencing of insulinoma reveals recurrent T372R mutations in YY1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24116200 2013 An upstream YY1 binding site on the HIV-1 LTR contributes to latent infection.
24105472 2014 NLRP7 affects trophoblast lineage differentiation, binds to overexpressed YY1 and alters CpG methylation.
24026176 2013 YY1 binds to ?-synuclein 3'-flanking region SNP and stimulates antisense noncoding RNA expression.
23919806 2013 Upregulation of Ying Yang 1 (YY1) suppresses esophageal squamous cell carcinoma development through heme oxygenase-1.
23874387 2013 Transcriptional repression of Bim by a novel YY1-RelA complex is essential for the survival and growth of Multiple Myeloma.
23813057 2013 Transcriptional regulation of human MUC4 gene: identification of a novel inhibitory element and its nuclear binding protein.
23776572 2013 Yin Yang 1 intronic binding sequences and splicing elicit intron-mediated enhancement of ubiquitin C gene expression.
23757039 2013 PLK1 and YY1 interaction in follicular lymphoma is associated with unfavourable outcome.
23630070 2013 RNA sequencing identifies fusion of the EWSR1 and YY1 genes in mesothelioma with t(14;22)(q32;q12).
23560079 2013 Phosphorylated C/EBP? influences a complex network involving YY1 and USF2 in lung epithelial cells.
23539139 2013 HCFC1 is a common component of active human CpG-island promoters and coincides with ZNF143, THAP11, YY1, and GABP transcription factor occupancy.
23523134 2013 Regulation of the varicella-zoster virus ORF3 promoter by cellular and viral factors.
23403125 2013 Identification of the general transcription factor Yin Yang 1 as a novel and specific binding partner for S6 kinase 2.
23385818 2013 Regulation of DU145 prostate cancer cell growth by Scm-like with four mbt domains 2.
23348961 2014 Yin Yang 1 promotes hepatic steatosis through repression of farnesoid X receptor in obese mice.
23328582 2013 Transcription factor YY1 contributes to tumor growth by stabilizing hypoxia factor HIF-1? in a p53-independent manner.
23226345 2012 The transcription factor YY1 is a novel substrate for Aurora B kinase at G2/M transition of the cell cycle.
23208495 2013 microRNA-7 is a novel inhibitor of YY1 contributing to colorectal tumorigenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22929025 2013 A rare variant in the osteoarthritis-associated locus GDF5 is functional and reveals a site that can be manipulated to modulate GDF5 expression.
22907428 2013 A novel miR-193a-5p-YY1-APC regulatory axis in human endometrioid endometrial adenocarcinoma.
22776217 2012 An investigation of the affinities, specificity and kinetics involved in the interaction between the Yin Yang 1 transcription factor and DNA.
22536409 2012 Positive and negative regulation of prostate stem cell antigen expression by Yin Yang 1 in prostate epithelial cell lines.
22467534 2012 Molecular characterization of a cancer-related single nucleotide polymorphism in the pro-inflammatory interleukin-1B gene.
22440256 2012 Yin Yang 1 plays an essential role in breast cancer and negatively regulates p27.
22391813 2012 Yin Yang-1 suppresses differentiation of hepatocellular carcinoma cells through the downregulation of CCAAT/enhancer-binding protein alpha.
22292071 2012 Pregnane X receptor and yin yang 1 contribute to the differential tissue expression and induction of CYP3A5 and CYP3A4.
22267549 2012 Galiximab signals B-NHL cells and inhibits the activities of NF-?B-induced YY1- and snail-resistant factors: mechanism of sensitization to apoptosis by chemoimmunotherapeutic drugs.
22262839 2012 Essential roles of Raf/extracellular signal-regulated kinase/mitogen-activated protein kinase pathway, YY1, and Ca2+ influx in growth arrest of human vascular smooth muscle cells by bilirubin.
22253417 2012 Angiotensin II-dependent transcriptional activation of human steroidogenic acute regulatory protein gene by a 25-kDa cAMP-responsive element modulator protein isoform and Yin Yang 1.
22248059 2011 Overexpression of Yin Yang 1 in the pathogenesis of human hematopoietic malignancies.
22248058 2011 Yin Yang 1 in human cancer.
22248057 2011 Yin Yang 2: the great unknown within the Yin Yang 1 regulatory network.
22248056 2011 Transcription regulator Yin-yang 1: from silence to cancer.
22248055 2011 The novel role of Yin Yang 1 in the regulation of epithelial to mesenchymal transition in cancer via the dysregulated NF-?B/Snail/YY1/RKIP/PTEN Circuitry.
22248054 2011 Oncogenic potential of yin yang 1 mediated through control of imprinted genes.
22248053 2011 The oncogenic role of Yin Yang 1.
22184066 2012 Phosphorylation of the transcription factor YY1 by CK2? prevents cleavage by caspase 7 during apoptosis.
22169291 2011 [Effects of DLL4 gene on YY1 and c-Myc protein expression and cell proliferation in leukemia cell line K562].
22065573 2011 Nuclear factor ?B subunits RelB and cRel negatively regulate Toll-like receptor 3-mediated ?-interferon production via induction of transcriptional repressor protein YY1.
21839814 2011 Negative transcriptional regulation of the human periostin gene by YingYang-1 transcription factor.
21795679 2011 Cellular content of UDP-N-acetylhexosamines controls hyaluronan synthase 2 expression and correlates with O-linked N-acetylglucosamine modification of transcription factors YY1 and SP1.
21792014 2011 YY1 is a novel potential therapeutic target for the treatment of HPV infection-induced cervical cancer by arsenic trioxide.
21729784 2011 YY1 tethers Xist RNA to the inactive X nucleation center.
21666725 2012 Yin Yang 1 positively regulates BRCA1 and inhibits mammary cancer formation.
21565439 2011 Yin Yang 1 expression and localisation in quadriceps muscle in COPD.
21454521 2011 The developmental regulator protein Gon4l associates with protein YY1, co-repressor Sin3a, and histone deacetylase 1 and mediates transcriptional repression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21385102 2011 Yin Yang-1(YY-1) expression in idiopathic pulmonary fibrosis.
21378158 2011 A DNA variant within the MYO7A promoter regulates YY1 transcription factor binding and gene expression serving as a potential dominant DFNA11 auditory genetic modifier.
21376359 2011 Role of the cellular transcription factor YY1 in the latent-lytic switch of Kaposi's sarcoma-associated herpesvirus.
21345358 2011 Hepatitis B virus protein up-regulated HLJ1 expression via the transcription factor YY1 in human hepatocarcinoma cells.
21332389 2011 Frequent alteration of the Yin Yang 1/Raf-1 kinase inhibitory protein ratio in hepatocellular carcinoma.
21326896 Yin Yang 1: a multifaceted protein beyond a transcription factor.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
21282644 2011 Signatures of murine B-cell development implicate Yy1 as a regulator of the germinal center-specific program.
21269460 2011 Initial characterization of the human central proteome.
21253604 2011 The transcription factor YY1 is a substrate for Polo-like kinase 1 at the G2/M transition of the cell cycle.
21182263 2011 Systematic proteome analysis identifies transcription factor YY1 as a direct target of miR-34a.
21076407 2010 A de novo paradigm for mental retardation.
21057508 2010 Yy1 as a molecular link between neuregulin and transcriptional modulation of peripheral myelination.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20805357 2010 The ubiquitin carboxyl hydrolase BAP1 forms a ternary complex with YY1 and HCF-1 and is a critical regulator of gene expression.
20686494 2011 Overexpression of the transcription factor Yin-Yang-1 suppresses differentiation of HaCaT cells in three-dimensional cell culture.
20666933 2010 DNA methylation and Yin Yang-1 repress adenosine A2A receptor levels in human brain.
20663886 2010 Histone modifiers, YY1 and p300, regulate the expression of cartilage-specific gene, chondromodulin-I, in mesenchymal stem cells.
20660740 2010 CXCR4/YY1 inhibition impairs VEGF network and angiogenesis during malignancy.
20596523 2010 Development and validation of a method for profiling post-translational modification activities using protein microarrays.
20519390 2010 Transcription factor YY1 interacts with retroviral integrases and facilitates integration of moloney murine leukemia virus cDNA into the host chromosomes.
20504995 2010 The MeCP2/YY1 interaction regulates ANT1 expression at 4q35: novel hints for Rett syndrome pathogenesis.
20431063 2010 Repressors NFI and NFY participate in organ-specific regulation of von Willebrand factor promoter activity in transgenic mice.
20430007 2010 Identification of Yin Yang 1-interacting partners at -1026C/A in the human iNOS promoter.
20237276 2010 Identification of a Smad4/YY1-recognized and BMP2-responsive transcriptional regulatory module in the promoter of mouse GABA transporter subtype I (Gat1) gene.
20233728 2010 Cis-acting genetic variation at an E2F1/YY1 response site and putative p53 site is associated with altered allele-specific expression of ERCC5 (XPG) transcript in normal human bronchial epithelium.
20215434 2010 Genome-wide analysis of YY2 versus YY1 target genes.
20105288 2010 Tungsten carbide cobalt nanoparticles exert hypoxia-like effects on the gene expression level in human keratinocytes.
20081375 2010 Yin yang 1 expression in human tumors.
20081364 2010 Yin Yang 1 overexpression in diffuse large B-cell lymphoma is associated with B-cell transformation and tumor progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20025767 2009 Investigating AP-2 and YY1 protein expression as a cause of high HER2 gene transcription in breast cancers with discordant HER2 gene amplification.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19879840 2009 Beta-arrestin1 regulates zebrafish hematopoiesis through binding to YY1 and relieving polycomb group repression.
19793915 2009 Regulation of the transcription factor YY1 in mitosis through phosphorylation of its DNA-binding domain.
19720140 2009 YY1-dependent transcriptional regulation of the human GDAP1 gene.
19712462 2009 YY1 is autoregulated through its own DNA-binding sites.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19685047 2009 FcepsilonRIalpha gene -18483A>C polymorphism affects transcriptional activity through YY1 binding.
19575798 2009 Cooperation between NRF-2 and YY-1 transcription factors is essential for triggering the expression of the PREPL-C2ORF34 bidirectional gene pair.
19566924 2009 The role of YY1 in reduced HP1alpha gene expression in invasive human breast cancer cells.
19553391 2009 Cellular factor YY1 downregulates the human papillomavirus 16 E6/E7 promoter, P97, in vivo and in vitro from a negative element overlapping the transcription-initiation site.
19483472 2009 PTEN suppression of YY1 induces HIF-2 activity in von-Hippel-Lindau-null renal-cell carcinoma.
19360355 2009 Transcription factor YY1 expression in human gastrointestinal cancer cells.
19297611 2009 Downregulation of vaccinia virus intermediate and late promoters by host transcription factor YY1.
19235591 2009 YY1 Over-expression in human brain gliomas and meningiomas correlates with TGF-beta1, IGF-1 and FGF-2 mRNA levels.
19164126 2009 The mechanism involved in the repression of the mu opioid receptor gene expression in CEM x174 cells infected by simian immunodeficiency virus.
19129193 2009 Identification of adjacent binding sites for the YY1 and E4BP4 transcription factors in the ovine PrP (Prion) gene promoter.
19034670 2009 YY1 and FoxD3 regulate antiretroviral zinc finger protein OTK18 promoter activation induced by HIV-1 infection.
18950698 2009 YY1's longer DNA-binding motifs.
18922472 2008 Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex.
18753137 2008 Epigenetic silencing of CCAAT/enhancer-binding protein delta activity by YY1/polycomb group/DNA methyltransferase complex.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18558095 2008 YY1 restrained cell senescence through repressing the transcription of p16.
18542060 2008 p300 provides a corepressor function by cooperating with YY1 and HDAC3 to repress c-Myc.
18488713 2008 Silencing of YY1 downregulates RIZ1 promoter in human osteosarcoma.
18485096 2008 The Yin and Yang of YY1 in the nervous system.
18480431 2008 Transcription factor YY1 and its associated acetyltransferases CBP and p300 interact with hepatitis delta antigens and modulate hepatitis delta virus RNA replication.
18424742 2008 Inhibition of Yin Yang 1-dependent repressor activity of DR5 transcription and expression by the novel proteasome inhibitor NPI-0052 contributes to its TRAIL-enhanced apoptosis in cancer cells.
18423564 2008 Yin-Yang 1 regulates effector cytokine gene expression and T(H)2 immune responses.
18391986 2008 Loss of p53 induces epidermal growth factor receptor promoter activity in normal human keratinocytes.
18389627 [Transcription factor YY1 participates in activation transcription of the human ribosomal protein L11 gene].
18339860 2008 Deletion of Yin Yang 1 protein in osteosarcoma cells on cell invasion and CXCR4/angiogenesis and metastasis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18026119 2007 A YY1-INO80 complex regulates genomic stability through homologous recombination-based repair.
17990281 2008 The role of transcription factors Sp1 and YY1 in proximal promoter region in initiation of transcription of the mu opioid receptor gene in human lymphocytes.
17980704 2008 Yin Yang 1 induces transcriptional activity of p73 through cooperation with E2F1.
17973241 2008 The CD30 gene promoter microsatellite binds transcription factor Yin Yang 1 (YY1) and shows genetic instability in anaplastic large cell lymphoma.
17973082 2008 YY1 repressing peroxisome proliferator-activated receptor delta promoter.
17925399 2007 Histone deacetylase 3 down-regulates cholesterol synthesis through repression of lanosterol synthase gene expression.
17721549 2007 YY1 functions with INO80 to activate transcription.
17556661 2007 Yin Yang-1 inhibits vascular smooth muscle cell growth and intimal thickening by repressing p21WAF1/Cip1 transcription and p21WAF1/Cip1-Cdk4-cyclin D1 assembly.
17549406 2007 Overexpression of VEGF and TGF-beta1 mRNA in Pap smears correlates with progression of cervical intraepithelial neoplasia to cancer: implication of YY1 in cervical tumorigenesis and HPV infection.
17434929 2007 The CBF1-independent Notch1 signal pathway activates human c-myc expression partially via transcription factor YY1.
17353273 2007 PIASy-mediated sumoylation of Yin Yang 1 depends on their interaction but not the RING finger.
17192956 2007 Synaptotagmin XI as a candidate gene for susceptibility to schizophrenia.
16963455 2006 Yin Yang 1 physically interacts with Hoxa11 and represses Hoxa11-dependent transcription.
16954376 2006 Binding of YY1 to the proximal region of the murine beta interferon promoter is essential to allow CBP recruitment and K8H4/K14H3 acetylation on the promoter region after virus infection.
16918502 2007 Differential regulation of human YY1 and caspase 7 promoters by prohibitin through E2F1 and p53 binding sites.
16769183 2006 A role for Yin Yang-1 (YY1) in the assembly of snRNA transcription complexes.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314846 2006 Transcription factor YY1: structure, function, and therapeutic implications in cancer biology.
16314465 2005 Cytoplasmic YY1 is associated with increased smooth muscle-specific gene expression: implications for neonatal pulmonary hypertension.
16260628 2005 Enhanceosome formation over the beta interferon promoter underlies a remote-control mechanism mediated by YY1 and YY2.
16170350 2006 Hepatitis C virus core protein recruits nucleolar phosphoprotein B23 and coactivator p300 to relieve the repression effect of transcriptional factor YY1 on B23 gene expression.
16143308 2005 Inhibition of the transcription factor Yin Yang 1 activity by S-nitrosation.
15955096 2005 Transcriptional regulation of ATP2C1 gene by Sp1 and YY1 and reduced function of its promoter in Hailey-Hailey disease keratinocytes.
15942652 2005 Expression of transcription factor Yin Yang 1 in prostate cancer.
15870067 2005 Yin Yang 1 cooperates with activator protein 2 to stimulate ERBB2 gene expression in mammary cancer cells.
15831475 2005 Caspase-dependent regulation and subcellular redistribution of the transcriptional modulator YY1 during apoptosis.
15805285 2005 Carboxyl-terminal Src kinase homologous kinase negatively regulates the chemokine receptor CXCR4 through YY1 and impairs CXCR4/CXCL12 (SDF-1alpha)-mediated breast cancer cell migration.
15782117 2005 The transcriptional factor YY1 upregulates the novel invasion suppressor HLJ1 expression and inhibits cancer cell invasion.
15674325 2005 PARP-10, a novel Myc-interacting protein with poly(ADP-ribose) polymerase activity, inhibits transformation.
15586248 2005 YY-1 and c-Jun transcription factors participate in the repression of the human involucrin promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15329343 2004 SMAD-mediated modulation of YY1 activity regulates the BMP response and cardiac-specific expression of a GATA4/5/6-dependent chick Nkx2.5 enhancer.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15295102 2004 YY1 inhibits the activation of the p53 tumor suppressor in response to genotoxic stress.
15291746 2004 YY1 binding within the human HSD3B2 gene intron 1 is required for maximal basal promoter activity: identification of YY1 as the 3beta1-A factor.
15210108 2004 Yin Yang 1 is a negative regulator of p53.
15153544 2004 A promoter haplotype of the immunoreceptor tyrosine-based inhibitory motif-bearing FcgammaRIIb alters receptor expression and associates with autoimmunity. II. Differential binding of GATA4 and Yin-Yang1 transcription factors and correlated receptor expression and function.
15084399 2004 YY1 is recruited to the cytoplasm of vaccinia virus-infected human macrophages by the Crm1 system.
12913000 2003 Association of transcription factor YY1 with the high molecular weight Notch complex suppresses the transactivation activity of Notch.
12808092 2003 Nuclear factor YY1 inhibits transforming growth factor beta- and bone morphogenetic protein-induced cell differentiation.
12805085 2003 Monocyte chemoattractant protein-4 core promoter genetic variants: influence on YY-1 affinity and plasma levels.
12788099 2003 Modulation of YY1 activity by SAP30.
12754214 2003 Yin Yang 1 is increased in human heart failure and represses the activity of the human alpha-myosin heavy chain promoter.
12588874 2003 YY1 is regulated by O-linked N-acetylglucosaminylation (O-glcNAcylation).
12571248 2003 YY1 transcription factor down-regulates expression of CCR5, a major coreceptor for HIV-1.
12483538 2002 YY1 and NF-Y binding sites regulate the transcriptional activity of the dek and dek-can promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411495 2002 Interaction of YY1 with E2Fs, mediated by RYBP, provides a mechanism for specificity of E2F function.
12393438 2003 The gene encoding the transcriptional regulator Yin Yang 1 (YY1) is a myeloid transforming gene interfering with neutrophilic differentiation.
11940654 2002 Counterregulation of chromatin deacetylation and histone deacetylase occupancy at the integrated promoter of human immunodeficiency virus type 1 (HIV-1) by the HIV-1 repressor YY1 and HIV-1 activator Tat.
11777930 2002 BRCA1 regulates GADD45 through its interactions with the OCT-1 and CAAT motifs.
11532945 2001 The FK506-binding protein 25 functionally associates with histone deacetylases and with transcription factor YY1.
11486036 2001 Regulation of transcription factor YY1 by acetylation and deacetylation.
11448987 2001 ZNF265--a novel spliceosomal protein able to induce alternative splicing.
11437367 2001 Poly(ADP-ribosyl)ation of transcription factor Yin Yang 1 under conditions of DNA damage.
11287625 2001 Identification of TFII-I as the endoplasmic reticulum stress response element binding factor ERSF: its autoregulation by stress and interaction with ATF6.
11158321 2001 The polycomb group protein EED interacts with YY1, and both proteins induce neural tissue in Xenopus embryos.
10888618 2000 The human factors YY1 and LSF repress the human immunodeficiency virus type 1 long terminal repeat via recruitment of histone deacetylase 1.
10866666 2000 ATF6 as a transcription activator of the endoplasmic reticulum stress element: thapsigargin stress-induced changes and synergistic interactions with NF-Y and YY1.
10452940 1999 Unlocking the mechanisms of transcription factor YY1: are chromatin modifying enzymes the key?
10369680 1999 RYBP, a new repressor protein that interacts with components of the mammalian Polycomb complex, and with the transcription factor YY1.
10224053 1999 Co-stimulation of promoter for low density lipoprotein receptor gene by sterol regulatory element-binding protein and Sp1 is specifically disrupted by the yin yang 1 protein.
9857059 1998 Transcriptional up-regulation of the delayed early gene HRS/SRp40 during liver regeneration. Interactions among YY1, GA-binding proteins, and mitogenic signals.
9685495 1998 Cloning, chromosomal localization and promoter analysis of the human transcription factor YY1.
9642075 1998 Design, synthesis and structure of a zinc finger with an artificial beta-turn.
9493912 1998 Targeting of the YY1 transcription factor to the nucleolus and the nuclear matrix in situ: the C-terminus is a principal determinant for nuclear trafficking.
9371597 1997 Repression of human immunodeficiency virus type 1 through the novel cooperation of human factors YY1 and LSF.
9346952 1997 Isolation and characterization of cDNAs corresponding to an additional member of the human histone deacetylase gene family.
9278494 1997 A functional YY1 binding site is necessary and sufficient to activate Surf-1 promoter activity in response to serum growth factors.
9016636 1997 Yeast two-hybrid cloning of a novel zinc finger protein that interacts with the multifunctional transcription factor YY1.
8942976 1996 Cocrystal structure of YY1 bound to the adeno-associated virus P5 initiator.
8289393 1994 Human transcription factor YY1 represses human immunodeficiency virus type 1 transcription and virion production.
8268924 1993 Binding of the ubiquitous nuclear transcription factor YY1 to a cis regulatory sequence in the human LINE-1 transposable element.
8266081 1993 Inhibition of transcriptional regulator Yin-Yang-1 by association with c-Myc.
7912122 1994 Chromosomal localization of the transcription factor YY1 in the mouse and human.
7853498 1995 Adenovirus E1A proteins interact with the cellular YY1 transcription factor.
7758944 1995 Relief of YY1 transcriptional repression by adenovirus E1A is mediated by E1A-associated protein p300.
7541038 1995 Cyclophilin A and FKBP12 interact with YY1 and alter its transcriptional activity.
1946405 1991 Isolation of a candidate repressor/activator, NF-E1 (YY-1, delta), that binds to the immunoglobulin kappa 3' enhancer and the immunoglobulin heavy-chain mu E1 site.
1655281 1991 Transcriptional repression by YY1, a human GLI-Krüppel-related protein, and relief of repression by adenovirus E1A protein.