Property Summary

NCBI Gene PubMed Count 302
PubMed Score 362.28
PubTator Score 161.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 2.045 1.6e-03
astrocytic glioma -2.000 1.5e-02
ependymoma -2.000 3.2e-02
oligodendroglioma -1.800 3.4e-02
glioblastoma -2.100 3.3e-06
group 4 medulloblastoma -2.000 1.3e-05
atypical teratoid / rhabdoid tumor -2.200 2.8e-08
medulloblastoma, large-cell -2.400 5.8e-05
primitive neuroectodermal tumor -1.500 4.6e-04
acute quadriplegic myopathy 1.031 3.5e-05
pancreatic ductal adenocarcinoma liver m... 1.308 1.5e-03
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
lung cancer -1.200 3.6e-03
Parkinson's disease -1.100 4.6e-02
breast carcinoma 2.200 2.9e-03
adult high grade glioma -2.100 8.5e-06
pilocytic astrocytoma -1.700 1.4e-06
lung adenocarcinoma 1.166 1.5e-07
Breast cancer 1.300 2.7e-06
invasive ductal carcinoma 1.200 3.8e-03
ovarian cancer 2.500 1.4e-04

Synonym

Accession P63104 A8K1N0 B7Z465 P29213 P29312 Q32P43 Q5XJ08 Q6GPI2 Q6IN74 Q6NUR9 Q6P3U9 Q86V33
Symbols HEL4
YWHAD
KCIP-1
HEL-S-3
HEL-S-93
14-3-3-zeta

Gene

PANTHER Protein Class (1)

PDB

4WRQ   1IB1   1QJA   1QJB   2C1J   2C1N   2O02   2WH0   3CU8   3NKX   3RDH   4BG6   4FJ3   4HKC   4IHL   4N7G   4N7Y   4N84   4ZDR   5D2D   5D3F   5EWZ   5EXA  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

 GWAS Trait (1)

Gene RIF (124)

PMID Text
27401462 Results indicate that HuR induces 14-3-3zeta translation via interaction with its 3' UTR and that 14-3-3zeta is necessary for stimulation of intestinal epithelial cell migration after wounding.
26906158 this study suggests that the down-regulation of 14-3-3 zeta leads to the inhibition of TGFb1- induced contraction by decreasing the expression of total RhoA in TM cells.
26884855 14-3-3zeta regulates HIF-1alpha production in hepatocellular carcinoma cells by directly binding to HIF-1alpha and via PI3K/Akt/NF-small ka, CyrillicB signal transduction pathway.
26616734 CEP131 is the key regulatory target of MK2 and 14-3-3 in centriolar satellite remodeling.
26429164 loss of expression or even the down-regulation of c-abl, but not WYHAZ, is a fundamental event that leads to genesis and progression of tumors
26295714 This study provides the molecular basis for C-Raf C-terminal-derived phosphopeptide interaction with 14-3-3zeta protein and gives structural insights responsible for phosphorylation-mediated protein binding.
26205494 Activation of PCTAIRE-1 is mediated through interaction with the phosphorylated form of cyclin Y in complex with 14-3-3.
25971962 C-terminal domain of Pdc interacts with the outside surface of the 14-3-3 dimer.
25861752 14-3-3z may play an important role in signaling pathway in breast cancer. Also, a high 14-3-3z expression could positively regulate growth factor receptors and protein kinase pathways
25670079 The 14-3-3zeta-driven contextual changes of Smad partners from p53 to Gli2 may serve as biomarkers and therapeutic targets of TGF-b-mediated cancer progression.
25556369 Studies show that 14-3-3zeta is overexpressed in oral squamous cell carcinoma and provide evidence that may regulate tumor inflammation and immune response through Stat3 signaling.
25418103 A detailed analysis of the interaction between singly or doubly phosphorylated human tyrosine hydroxylase isoform 1(1-50) peptides and 14-3-3zeta
25412315 BIS targeting induces cellular senescence through the regulation of 14-3-3 zeta/STAT3/SKP2/p27 in glioblastoma cells.
25266655 Data found that the interaction between 14-3-3 zeta and Atg9A is mediated by phosphorylation at Ser761.
25226601 Aberrant upregulation of 14-3-3sigma and EZH2 expression serves as an inferior prognostic biomarker for hepatocellular carcinoma.
25156059 Our findings indicate that YWHAZ could serve as a promising prognostic biomarker in localized PCa to predict poor prognosis
25138042 studyconfirmed the interaction of Ser9-phosphorylated GSK3beta with 14-3-3zeta; Ser9-phosphorylation of GSK3beta promoted by 14-3-3zeta is critical for the activation of NF-kappaB pathway
24956593 14-3-3zeta regulates nuclear trafficking of PP1alpha in mammalian cells
24812321 By preventing the inactivation of cofilin, metabolic stress-induced degradation of 14-3-3zeta promotes the conversion of blood monocytes into a hypermigratory, proatherogenic phenotype.
24804299 Data suggest that the combined expression of 14-3-3zeta and Hsp27 may be a biomarker for predicting survival in patients with NSCLC, and this combination may have potential as a therapeutic target for NSCLC.
24708873 miR-375-mediated regulation of 14-3-3zeta contributes to decrease telomerase activity by altering nuclear translocation of TERT.
24603438 Compared to HL-60 cells, multidrug-resistant HL-60/VCR cells had increased 14-3-3zeta mRNA and protein expression.Silencing of 14-3-3zeta increased the sensitivity of both sensitive and resistant HL-60 cells to TPT-induced apoptosis.
24367683 14-3-3zeta causes synaptic loss by destabilizing microtubules, leading to proteosomal degradation of synaptophysin in the neurons of patients suffering from Alzheimer's disease.
24282540 BiFC assays demonstrate that 14-3-3 zeta directly interacts with HIV-1 Vpr in the nulceus of HeLa cells
24269678 Data indicate that 14-3-3 zeta, gamma, epsilon, and tau isoforms but not the sigma protein hydrolyze ATP.
24114522 Somatic copy number alterations by whole-exome sequencing implicates YWHAZ and PTK2 in castration-resistant prostate cancer.
24043626 dimerization appears to be required for the function of 14-3-3sigma.
23999528 Among the genes found disrupted in this study, there is evidence suggesting that YWHAZ and also the X-linked DRP2 may be considered as novel autism candidate genes.
23977325 physiological changes in phosphate anions concentration can modulate affinity and specificity of interaction of 14-3-3 with its multiple targets and therefore the actual phosphointeractome of 14-3-3.
23962087 Our data suggest that 14-3-3zeta has a role in the fibrillization of tau in AD brain, and that tau phosphorylation does not affect 14-3-3zeta-induced tau aggregation.
23754751 The activated serine/threonine kinase Akt/protein kinase B phosphorylated BTK on two sites prior to 14-3-3 zeta binding.
23622247 Study reports a high-affinity 14-3-3-binding site at the C terminus of Rnd3 consisting of both the Cys241-farnesyl moiety and a Rho-associated coiled coil containing protein kinase (ROCK)-dependent Ser240 phosphorylation site.
23603156 results suggest that 14-3-3zeta may be an endogenous physiologic regulator of HNF1alpha
23422756 Overexpression of YWHAZ relates to tumor cell proliferation and malignant outcome of gastric carcinoma.
23364796 BiFC assays demonstrate that 14-3-3 zeta directly interacts with HIV-1 Vpr in the nulceus of HeLa cells
23318431 these data show that ionizing radiation-mediated activation of ErbB2 and induction of 14-3-3zeta collaborate to regulate FoxM1 and promote invasion of breast cancer cells
23316005 alphaB-Crystallin complexes with and elevates 14-3-3zeta protein, leading to up-regulation of ERK1/2 activity and progression in hepatocellular carcinoma.
23271328 14-3-3zeta as a predictor of early time to recurrence and distant metastasis in hormone receptor-positive and -negative breast cancers.
23269842 Data indicate that fusicoccin (FC)-mediated dimerization of the NF-kappaB-C terminus(CT) with a constitutively nuclear-localized 14-3-3 protein led to an NF-kappaB-specific cellular response by inducing IL-8 secretion.
23175360 The interaction is direct and specific for the high-risk HPV E6 oncoproteins, although there are significant differences in the efficiencies with which HPV-16, HPV-18, and HPV-31 E6 oncoproteins can associate with 14-3-3zeta.
22989890 Data indicate that 14-3-3zeta interaction with kappa-opioid receptor (hKOPR) C-tail promotes export of hKOPR.
22922483 Determination of a 1:1 stoichiometry for the diphosphorylated peptide binding to one 14-3-3zeta dimer with isothermal titration calorimetry was supported by the crystal structure of the 14-3-3zeta/C-RAFpS233,pS259 complex.
22912335 This is the first demonstration showing YWHAZ through its complex with beta-catenin in mediating lung cancer malignancy and beta-catenin protein stability.
22904106 14-3-3 zeta is a novel androgen-responsive gene that activates proliferation, cell survival, and androgen receptor transcriptional activity
22808202 14-3-3zeta enhances prostate cancer cell-matrix interactions, motility and transendothelial migration in vitro via activation of Rac1-GTPase and is an important target for therapeutic interventions for prostate cancer.
22794279 14-3-3zeta and possibly other 14-3-3 isoforms may have additional functional roles conducted by the monomeric state
22450169 cofilins 1 and 2 only weakly interact with 14-3-3 and therefore cannot directly compete with phosphorylated small heat shock protein HspB6 for its binding to 14-3-3 zeta
22279540 Findings show that multiple signaling events impinge on Stat3 and that 14-3-3zeta serves as an essential coordinator for different pathways to regulate Stat3 activation and function in multiple myeloma cells.
22190034 BiFC assays demonstrate that 14-3-3 zeta directly interacts with HIV-1 Vpr in the nulceus of HeLa cells
22124272 data provide the first evidence of a direct role for 14-3-3 zeta deficiency in the aetiology of neurodevelopmental disorders andas a central risk factor in schizophrenia.
22069327 the function of nuclear RACK1 is mediated through its interaction with 14-3-3zeta
22010828 14-3-3 proteins mediate CaR-dependent Rho signalling and may modulate the plasma membrane expression of the CaR.
21978388 Properties of the monomeric form of 14-3-3zeta protein and its interaction with tau and HspB6. This interaction requires phosphorylation of tau protein and HspB6.
21965683 14-3-3 binding and phosphorylation of neuroglobin during hypoxia modulate six-to-five heme pocket coordination and rate of nitrite reduction to nitric oxide
21743495 Data show that mutation of serine 83 to alanine on p85 inhibited 14-3-3zeta binding to the p85 subunit of PI3K.
21707964 14-3-3zeta is a key predictive marker for risk of failure on endocrine therapy and serves a pivotal role impacting growth factor signaling, and promoting cell survival and resistance to endocrine therapies.
21621563 data support a model where both AKT and 14-3-3 zeta positively regulate FoxO3 in addition to their established negative roles and that 14-3-3 zeta availability could dictate the fate of phosphorylated FoxO3 toward degradation or recycling
21554249 NMR spectroscopy revealed the presence of a flexible and unstructured C-terminal extension, 12 amino acids in length, which protrudes from the domain core of 14-3-3zeta and is similar in to the C-terminal extension of heat shock proteins.
21334806 14-3-3zeta silencing in hepatocellular carcinoma inhibits tumor growth and enhances chemosensitivity to cis-diammined dichloridoplatium
21302295 These findings suggest a previously unrecognized mechanism of integrin-induced Rac1 activation in which 14-3-3 dimers localize Tiam1 to integrin complexes, where it mediates integrin-dependent Rac1 activation, thus initiating motility-inducing pathways.
21242845 Glioblastoma patients in the 14-3-3zeta positive group have lower overall survival rates and median survival time compared to those in the 14-3-3zetanegative group.
21118500 Guggulsterone targets 14-3-3 zeta associated cellular pathways for reducing proliferation and inducing apoptosis in head and neck cancer cells.
21081103 The 14-3-3 zeta mutation mimicking phosphorylation of Ser184 does not markedly affect interaction with tau protein and improves the interaction of 14-3-3 zeta with HspB6.
21028892 Data show that the expression of 14-3-3 zeta was associated with the degree of cancer peritoneal metastasis.
20885446 14-3-3zeta proteins are shown as a negative regulator of autophagy through regulation of a key component of early stages of the autophagy pathway, such as hVps34.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20388496 The 14-3-3 epsilon, zeta and theta may be involved in tumorigenesis of meningioma and be efficient markers for predicting the degree of malignancy in meningioma.
20384366 Yeast BMH1 and BMH2 possess a distinctly variant C-terminal compared to human 14-3-3 zeta protein.
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20308060 The PX-RICS-14-3-3zeta/theta complex couples N-cadherin-beta-catenin with dynein-dynactin to mediate its export from the endoplasmic reticulum.
20012529 BiFC assays demonstrate that 14-3-3 zeta directly interacts with HIV-1 Vpr in the nulceus of HeLa cells
19875727 Identification of a novel 14-3-3zeta binding site within the cytoplasmic domain of platelet glycoprotein Ibalpha that plays a key role in regulating the von Willebrand factor binding function of glycoprotein Ib-IX.
19732720 14-3-3zeta cooperates with ErbB2 to promote ductal carcinoma in situ progression to invasive breast cancer by inducing epithelial-mesenchymal transition.
19662078 Study reports the crystal structure of 14-3-3zeta bound to a synthetic diphosphorylated PKCepsilon V3 region revealing how a consensus 14-3-3 site and a divergent 14-3-3 site cooperate to bind to 14-3-3 and so activate PKCepsilon.
19647741 Data suggest that the state of tau3 phosphorylation by protein kinase A affects the mode of 14-3-3zeta binding and by this means might modify tau filament formation.
19525224 14-3-3zeta mediates resistance of diffuse large B cell lymphoma to an anthracycline-based chemotherapeutic regimen
19401330 An integrin-alpha4-14-3-3zeta-paxillin ternary complex mediates localised Cdc42 activity and accelerates cell migration.
19371722 These results implicate 14-3-3zeta/tau heterodimers as key regulators of SSH1 activity in keratinocytes and suggest they play a role in cytoskeleton remodeling during cell migration.
19218246 14-3-3z:Shc scaffolds can act as multivalent signaling nodes for the integration of both phosphoserine/threonine and phosphotyrosine pathways to regulate specific cellular responses.
19198587 The authors report that phosphorylation leads to the unfolding of the structurally atypical and unstable KH1, creating a site for 14-3-3zeta binding.
19184136 Observational study of gene-disease association. (HuGE Navigator)
19173300 changes in the expression of five 14-3-3 isoforms (beta, gamma, epsilon, tau, and zeta) during the apoptosis of JURL-MK1 and K562 cells.
19138662 Phosphorylation by cAMP-dependent protein kinase strongly enhanced interaction of tau3 with 14-3-3.
19062179 study presents the cellular translocation of 14-3-3 zeta in JC virus(JCV) nonsusceptible progenitors and JCV-susceptible progenitor-derived astrocytes; results suggest that the nuclear presence of 14-3-3 zeta may play a role in JCV infection
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
18618111 Immunofluorescent staining for 14-3-3 zeta demonstrated expression of the protein on ascitic and peritumoral macrophages in epithelial ovarian carcinoma patients
18573912 14-3-3epsilon and 14-3-3zeta are identified as Cby-binding partners.
18559254 structure & properties of wild type 14-3-3zeta & point mutants S58E, S184E, T232E & mutant S58E/S184E/T232E mimicking phosphorylation; mutation mimicking phosphorylation of Ser58 destabilized & mutation of Ser184 induced stabilization of 14-3-3zeta
18472156 PKC delta in preeclamptic placentas promotes Bax dissociation from 14-3-3 zeta through 14-3-3 zeta phosphorylation.
18319590 combined gene effects between 14-3-3 zeta (intron 4, rs 983583) polymorphism and tau (intron 9, rs 2471738) polymorphism might be responsible for susceptibility to Alzheimer disease
18319590 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18290843 14-3-3 zeta protein and butyrylcholinesterase (BCHE) synergistic effects between polymorphisms in tau phosphorylation relate-genes may help in determining the risk profile for AD.
18290843 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18162532 14-3-3zeta has a critical role in anoikis suppression in lung cancer cells
18078716 Our data support a novel role for 14-3-3zeta in the aggregate formation of nonnative, aggregation-prone proteins.
17918986 14-3-3zeta is a granule protein related to atherosclerosis
17764575 findings suggest that over-expression of 14-3-3zeta is an early event in oral tumorigenesis and may have an important role in its development and progression
17704798 Knockdown of 14-3-3 zeta induces at least two isoform-specific phenotypes that are consistent with potential oncogenic activity during tumorigenesis.
17317006 Our data demonstrate that 14-3-3zeta mediates tau phosphorylation by Ser9-phosphorylated GSK3beta in HEK-293 cells.
16968670 BiFC assays demonstrate that 14-3-3 zeta directly interacts with HIV-1 Vpr in the nulceus of HeLa cells
16123035 14-3-3 binds to protein C-terminal domains
15721295 binding of 14-3-3 to Par3beta is dependent on phosphorylation
15708996 BiFC assays demonstrate that 14-3-3 zeta directly interacts with HIV-1 Vpr in the nulceus of HeLa cells
15616007 Vpr interferes with the suppressive effects of insulin on FOXO-mediated transcription of target genes via 14-3-3. (14-3-3 Protein)
15363479 YWHAZ gene is a susceptibility gene for paranoid schizophrenia
15347690 FRET analysis of 14-3-3 protein C-terminal stretch
15265780 BiFC assays demonstrate that 14-3-3 zeta directly interacts with HIV-1 Vpr in the nulceus of HeLa cells
15234461 a 14-3-3 zeta implication in the Alzheimer's neuropathology
15225635 EGF-induced co-localization of mouse EGFR and human 14-3-3zeta along the plasma membrane.
15142377 BiFC assays demonstrate that 14-3-3 zeta directly interacts with HIV-1 Vpr in the nulceus of HeLa cells
15073173 within the tau phosphorylation complex, 14-3-3 connects Ser(9)-phosphorylated GSK3beta to tau and Ser(9)-phosphorylated GSK3beta phosphorylates tau
15054037 existence of a second major 14-3-3zeta binding site within the cytoplasmic tail of GPIbalpha that has an important functional role in regulating integrin-dependent cell spreading.
15037601 14-3-3zeta is a specific substrate for YSK1 that localizes to the Golgi apparatus, and potentially links YSK1 signaling at the Golgi apparatus with protein transport.
15036595 Zeta 14-3-3 protein facilitates tau assembly into fibrillar polymers, with polymerization reduced but not abolished, when tau is modified by protein kinase A.
14690436 In the presence of 14-3-3, the requirement of two phosphorylated 14-3-3 zeta binding motifs for the complete inhibition of FOXO4 binding to its target DNA is demonstrated.
12861023 14-3-3zeta has a role in MAPKAPK2-mediated phosphorylation, which may represent a novel pathway mediating p38 MAPK-dependent inflammation
12589811 role for the 14-3-3zeta/ADAM 22 association in the regulation of cell adhesion and related signaling events
12364343 TSC2 associates with 14-3-3 in vivo
12323073 binds cofilin and LIM-domain-containing protein kinase 1
12176984 14-3-3 zeta binds with tuberin to regulate phosphorylation of ribosomal protein S6
11956222 Identification of 14-3-3zeta as a protein kinase B/Akt substrate.
11531413 BiFC assays demonstrate that 14-3-3 zeta directly interacts with HIV-1 Vpr in the nulceus of HeLa cells
10407019 Alpha-synuclein, a small presynaptic protein implicated in Parkinson's disease and other neurodegenerative disorders, interacts with 14-3-3 and both proteins appear to differentially regulate the activities of important cellular enzymes.

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE      1 - 70
GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKG     71 - 140
IVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEES    141 - 210
YKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN                                       211 - 245
//

Text Mined References (323)

PMID Year Title
27401462 2016 Posttranscriptional regulation of 14-3-3? by RNA-binding protein HuR modulating intestinal epithelial restitution after wounding.
26906158 2016 Down-regulation of 14-3-3 Zeta Inhibits TGF-?1-Induced Actomyosin Contraction in Human Trabecular Meshwork Cells Through RhoA Signaling Pathway.
26884855 2015 14-3-3? up-regulates hypoxia-inducible factor-1? in hepatocellular carcinoma via activation of PI3K/Akt/NF-?B signal transduction pathway.
26616734 2015 p38- and MK2-dependent signalling promotes stress-induced centriolar satellite remodelling via 14-3-3-dependent sequestration of CEP131/AZI1.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26429164 2015 c-abl and YWHAZ gene expression in gastric cancer.
26295714 2015 Biophysical Characterization of Essential Phosphorylation at the Flexible C-Terminal Region of C-Raf with 14-3-3? Protein.
26205494 2015 Cyclin Y phosphorylation- and 14-3-3-binding-dependent activation of PCTAIRE-1/CDK16.
26047703 2015 Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins.
25971962 2015 Structural Characterization of Phosducin and Its Complex with the 14-3-3 Protein.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25861752 2015 Involvement of multiple cellular pathways in regulating resistance to tamoxifen in BIK-suppressed MCF-7 cells.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25670079 2015 14-3-3? turns TGF-?'s function from tumor suppressor to metastasis promoter in breast cancer by contextual changes of Smad partners from p53 to Gli2.
25556369 2015 14-3-3? regulates immune response through Stat3 signaling in oral squamous cell carcinoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25418103 2014 Dissection of binding between a phosphorylated tyrosine hydroxylase peptide and 14-3-3zeta: A complex story elucidated by NMR.
25412315 2014 BIS targeting induces cellular senescence through the regulation of 14-3-3 zeta/STAT3/SKP2/p27 in glioblastoma cells.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
25266655 2014 Metabolic-stress-induced rearrangement of the 14-3-3? interactome promotes autophagy via a ULK1- and AMPK-regulated 14-3-3? interaction with phosphorylated Atg9.
25226601 2014 Aberrant upregulation of 14-3-3? and EZH2 expression serves as an inferior prognostic biomarker for hepatocellular carcinoma.
25156059 2014 Prognostic significance of YWHAZ expression in localized prostate cancer.
25138042 2014 Ser9-phosphorylated GSK3? induced by 14-3-3? actively antagonizes cell apoptosis in a NF-?B dependent manner.
24956593 2014 14-3-3? regulates nuclear trafficking of protein phosphatase 1? (PP1?) in HEK-293 cells.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24812321 2014 Redox regulation of 14-3-3? controls monocyte migration.
24804299 2014 The overexpression of 14-3-3? and Hsp27 promotes non–small cell lung cancer progression.
24708873 2014 miR-375 activates p21 and suppresses telomerase activity by coordinately regulating HPV E6/E7, E6AP, CIP2A, and 14-3-3?.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24603438 2014 Increased 14-3-3? expression in the multidrug-resistant leukemia cell line HL-60/VCR as compared to the parental line mediates cell growth and apoptosis in part through modification of gene expression.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
24367683 2013 Overexpression of 14-3-3z promotes tau phosphorylation at Ser262 and accelerates proteosomal degradation of synaptophysin in rat primary hippocampal neurons.
24351927 2014 Parkinson-related LRRK2 mutation R1441C/G/H impairs PKA phosphorylation of LRRK2 and disrupts its interaction with 14-3-3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269678 2014 Identification of a novel ATPase activity in 14-3-3 proteins--evidence from enzyme kinetics, structure guided modeling and mutagenesis studies.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24114522 2013 Somatic copy number alterations by whole-exome sequencing implicates YWHAZ and PTK2 in castration-resistant prostate cancer.
24043626 2013 Determinants of 14-3-3? protein dimerization and function in drug and radiation resistance.
23999528 2014 Exome sequencing in multiplex autism families suggests a major role for heterozygous truncating mutations.
23977325 2013 Modulation of 14-3-3/phosphotarget interaction by physiological concentrations of phosphate and glycerophosphates.
23962087 2013 Interaction of 14-3-3? with microtubule-associated protein tau within Alzheimer's disease neurofibrillary tangles.
23754751 2013 Dual phosphorylation of Btk by Akt/protein kinase b provides docking for 14-3-3?, regulates shuttling, and attenuates both tonic and induced signaling in B cells.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23622247 2013 14-3-3 proteins interact with a hybrid prenyl-phosphorylation motif to inhibit G proteins.
23603156 2013 14-3-3? interacts with hepatocyte nuclear factor 1? and enhances its DNA binding and transcriptional activation.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23572552 2013 ACBD3 interaction with TBC1 domain 22 protein is differentially affected by enteroviral and kobuviral 3A protein binding.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23422756 2013 Overexpression of YWHAZ relates to tumor cell proliferation and malignant outcome of gastric carcinoma.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23397142 2013 Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
23318431 2014 ErbB2, FoxM1 and 14-3-3? prime breast cancer cells for invasion in response to ionizing radiation.
23316005 2013 ?B-crystallin complexes with 14-3-3? to induce epithelial-mesenchymal transition and resistance to sorafenib in hepatocellular carcinoma.
23271328 2013 14-3-3? as a predictor of early time to recurrence and distant metastasis in hormone receptor-positive and -negative breast cancers.
23269842 2013 Activation of NF-?B signalling by fusicoccin-induced dimerization.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23175360 2013 High-risk human papillomavirus E6 oncoproteins interact with 14-3-3? in a PDZ binding motif-dependent manner.
23075850 2012 Progressive degeneration of human neural stem cells caused by pathogenic LRRK2.
22989890 2012 14-3-3? Protein regulates anterograde transport of the human ?-opioid receptor (hKOPR).
22922483 2012 Synergistic binding of the phosphorylated S233- and S259-binding sites of C-RAF to one 14-3-3? dimer.
22912335 2012 A novel function of YWHAZ/?-catenin axis in promoting epithelial-mesenchymal transition and lung cancer metastasis.
22904106 2012 14-3-3?, a novel androgen-responsive gene, is upregulated in prostate cancer and promotes prostate cancer cell proliferation and survival.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22808202 2012 Rac1 activation driven by 14-3-3? dimerization promotes prostate cancer cell-matrix interactions, motility and transendothelial migration.
22794279 2012 Monomeric 14-3-3? has a chaperone-like activity and is stabilized by phosphorylated HspB6.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22653443 2012 Mutant p53 interactome identifies nardilysin as a p53R273H-specific binding partner that promotes invasion.
22580824 2012 ARF6 GTPase protects the post-mitotic midbody from 14-3-3-mediated disintegration.
22575644 2012 14-3-3 interacts with LKB1 via recognizing phosphorylated threonine 336 residue and suppresses LKB1 kinase function.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22450169 2012 Cofilin weakly interacts with 14-3-3 and therefore can only indirectly participate in regulation of cell motility by small heat shock protein HspB6 (Hsp20).
22279540 2012 14-3-3? interacts with stat3 and regulates its constitutive activation in multiple myeloma cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22124272 2012 Neurodevelopmental and neuropsychiatric behaviour defects arise from 14-3-3? deficiency.
22069327 2012 Direct interaction between scaffolding proteins RACK1 and 14-3-3? regulates brain-derived neurotrophic factor (BDNF) transcription.
22010828 2012 The adaptor protein 14-3-3 binds to the calcium-sensing receptor and attenuates receptor-mediated Rho kinase signalling.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21978388 2011 Properties of the monomeric form of human 14-3-3? protein and its interaction with tau and HspB6.
21965683 2011 14-3-3 binding and phosphorylation of neuroglobin during hypoxia modulate six-to-five heme pocket coordination and rate of nitrite reduction to nitric oxide.
21743495 2012 Overexpression of 14-3-3? in cancer cells activates PI3K via binding the p85 regulatory subunit.
21707964 2011 Reversal of endocrine resistance in breast cancer: interrelationships among 14-3-3?, FOXM1, and a gene signature associated with mitosis.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21621563 2011 Bimodal regulation of FoxO3 by AKT and 14-3-3.
21554249 2011 NMR spectroscopy of 14-3-3? reveals a flexible C-terminal extension: differentiation of the chaperone and phosphoserine-binding activities of 14-3-3?.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21334806 2011 Silencing of 14-3-3? over-expression in hepatocellular carcinoma inhibits tumor growth and enhances chemosensitivity to cis-diammined dichloridoplatium.
21302295 2011 Tiam1 is recruited to ?1-integrin complexes by 14-3-3? where it mediates integrin-induced Rac1 activation and motility.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
21269460 2011 Initial characterization of the human central proteome.
21242845 2011 14-3-3? positive expression is associated with a poor prognosis in patients with glioblastoma.
21118500 2010 14-3-3 zeta is a molecular target in guggulsterone induced apoptosis in head and neck cancer cells.
21081150 2011 Pore-forming activity of BAD is regulated by specific phosphorylation and structural transitions of the C-terminal part.
21081103 2011 Phosphomimicking mutations of human 14-3-3? affect its interaction with tau protein and small heat shock protein HspB6.
21028892 2010 LC-MS/MS analysis of ovarian cancer metastasis-related proteins using a nude mouse model: 14-3-3 zeta as a candidate biomarker.
20936779 2010 A human MAP kinase interactome.
20885446 2011 Regulation of autophagic activity by 14-3-3? proteins associated with class III phosphatidylinositol-3-kinase.
20679480 2010 Impaired binding of 14-3-3 to C-RAF in Noonan syndrome suggests new approaches in diseases with increased Ras signaling.
20642453 2010 14-3-3 binding to LRRK2 is disrupted by multiple Parkinson's disease-associated mutations and regulates cytoplasmic localization.
20618440 2010 Proteomic and biochemical analysis of 14-3-3-binding proteins during C2-ceramide-induced apoptosis.
20603015 2010 Identification of KIAA1018/FAN1, a DNA repair nuclease recruited to DNA damage by monoubiquitinated FANCD2.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20451386 2010 Aurora B and 14-3-3 coordinately regulate clustering of centralspindlin during cytokinesis.
20388496 2010 The expression of seven 14-3-3 isoforms in human meningioma.
20384366 2010 The C-terminal segment of yeast BMH proteins exhibits different structure compared to other 14-3-3 protein isoforms.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20332113 2010 CCM3/PDCD10 stabilizes GCKIII proteins to promote Golgi assembly and cell orientation.
20308060 2010 The PX-RICS-14-3-3zeta/theta complex couples N-cadherin-beta-catenin with dynein-dynactin to mediate its export from the endoplasmic reticulum.
20224040 2010 Histone deacetylase 7 controls endothelial cell growth through modulation of beta-catenin.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20052757 2010 Molecular and clinical analysis of RAF1 in Noonan syndrome and related disorders: dephosphorylation of serine 259 as the essential mechanism for mutant activation.
20037628 2009 Phosphorylation of S776 and 14-3-3 binding modulate ataxin-1 interaction with splicing factors.
19933840 2010 Regulation of IRSp53-dependent filopodial dynamics by antagonism between 14-3-3 binding and SH3-mediated localization.
19875727 2009 Identification of a novel 14-3-3zeta binding site within the cytoplasmic domain of platelet glycoprotein Ibalpha that plays a key role in regulating the von Willebrand factor binding function of glycoprotein Ib-IX.
19860830 2009 The interaction between casein kinase Ialpha and 14-3-3 is phosphorylation dependent.
19766566 2009 Histone crosstalk between H3S10ph and H4K16ac generates a histone code that mediates transcription elongation.
19732720 2009 14-3-3zeta Cooperates with ErbB2 to promote ductal carcinoma in situ progression to invasive breast cancer by inducing epithelial-mesenchymal transition.
19725078 2009 Proteomic analysis of increased Parkin expression and its interactants provides evidence for a role in modulation of mitochondrial function.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19667065 2009 Identification of novel in vivo phosphorylation sites of the human proapoptotic protein BAD: pore-forming activity of BAD is regulated by phosphorylation.
19662078 2009 Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon.
19647741 2009 Phosphorylation of more than one site is required for tight interaction of human tau protein with 14-3-3zeta.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19525224 2009 14-3-3zeta mediates resistance of diffuse large B cell lymphoma to an anthracycline-based chemotherapeutic regimen.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19401330 2009 An integrin-alpha4-14-3-3zeta-paxillin ternary complex mediates localised Cdc42 activity and accelerates cell migration.
19371722 2009 14-3-3zeta/tau heterodimers regulate Slingshot activity in migrating keratinocytes.
19357195 2009 Shear stress induced reorganization of the keratin intermediate filament network requires phosphorylation by protein kinase C zeta.
19218246 2009 14-3-3:Shc scaffolds integrate phosphoserine and phosphotyrosine signaling to regulate phosphatidylinositol 3-kinase activation and cell survival.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19198587 2009 Phosphorylation-mediated unfolding of a KH domain regulates KSRP localization via 14-3-3 binding.
19184136 2009 Examination of association of genes in the serotonin system to autism.
19173300 2009 Isoform-specific cleavage of 14-3-3 proteins in apoptotic JURL-MK1 cells.
19172738 2008 Phosphorylation-dependent binding of 14-3-3 terminates signalling by the Gab2 docking protein.
19138662 2009 Effect of phosphorylation on interaction of human tau protein with 14-3-3zeta.
19062179 2009 Glial cell type-specific subcellular localization of 14-3-3 zeta: an implication for JCV tropism.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19049963 2009 Regulation of RAF activity by 14-3-3 proteins: RAF kinases associate functionally with both homo- and heterodimeric forms of 14-3-3 proteins.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18647389 2008 The central proline rich region of POB1/REPS2 plays a regulatory role in epidermal growth factor receptor endocytosis by binding to 14-3-3 and SH3 domain-containing proteins.
18618111 2009 14-3-3 zeta protein secreted by tumor associated monocytes/macrophages from ascites of epithelial ovarian cancer patients.
18573912 2008 Chibby cooperates with 14-3-3 to regulate beta-catenin subcellular distribution and signaling activity.
18559254 2008 Effect of mutations mimicking phosphorylation on the structure and properties of human 14-3-3zeta.
18472156 2008 PKC delta in preeclamptic placentas promotes Bax dissociation from 14-3-3 zeta through 14-3-3 zeta phosphorylation.
18418070 2008 Modulation of 14-3-3 interaction with phosphorylated histone H3 by combinatorial modification patterns.
18319590 2008 14-3-3 zeta and tau genes interactively decrease Alzheimer's disease risk.
18290843 2008 Gene-gene interaction between 14-3-3 zeta and butyrylcholinesterase modulates Alzheimer's disease risk.
18162532 2008 Down-regulation of 14-3-3zeta suppresses anchorage-independent growth of lung cancer cells through anoikis activation.
18078716 2008 14-3-3zeta is indispensable for aggregate formation of polyglutamine-expanded huntingtin protein.
18039662 2008 Cyclic nucleotide-dependent protein kinases inhibit binding of 14-3-3 to the GTPase-activating protein Rap1GAP2 in platelets.
17979178 2007 A novel tandem affinity purification strategy for the efficient isolation and characterisation of native protein complexes.
17918986 2007 Organellar proteomics of human platelet dense granules reveals that 14-3-3zeta is a granule protein related to atherosclerosis.
17913709 2007 Regulation of Nox1 activity via protein kinase A-mediated phosphorylation of NoxA1 and 14-3-3 binding.
17764575 2007 Over-expression of 14-3-3zeta is an early event in oral cancer.
17719568 2007 Subtractive hybridisation screen identifies genes regulated by glucose deprivation in human neuroblastoma cells.
17704798 2008 Cellular functions of 14-3-3 zeta in apoptosis and cell adhesion emphasize its oncogenic character.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17317006 2007 14-3-3zeta facilitates GSK3beta-catalyzed tau phosphorylation in HEK-293 cells by a mechanism that requires phosphorylation of GSK3beta on Ser9.
17235285 2007 Phosphorylation-independent interaction between 14-3-3 and exoenzyme S: from structure to pathogenesis.
17166838 2007 14-3-3 protein interacts with Huntingtin-associated protein 1 and regulates its trafficking.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16959763 2006 Transgenic mouse proteomics identifies new 14-3-3-associated proteins involved in cytoskeletal rearrangements and cell signaling.
16868027 2006 Efficient ADAM22 surface expression is mediated by phosphorylation-dependent interaction with 14-3-3 protein family members.
16679322 2006 Inhibitory interaction of the plasma membrane Na+/Ca2+ exchangers with the 14-3-3 proteins.
16672277 2006 Amino acids C-terminal to the 14-3-3 binding motif in CDC25B affect the efficiency of 14-3-3 binding.
16636147 2006 Activity of TSC2 is inhibited by AKT-mediated phosphorylation and membrane partitioning.
16581770 2006 Subcellular targeting of p33ING1b by phosphorylation-dependent 14-3-3 binding regulates p21WAF1 expression.
16516142 2006 CPAP interacts with 14-3-3 in a cell cycle-dependent manner.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16449798 2006 Thioredoxin-ASK1 complex levels regulate ROS-mediated p38 MAPK pathway activity in livers of aged and long-lived Snell dwarf mice.
16413928 2006 14-3-3zeta interacts with human thromboxane receptors and is involved in the agonist-induced activation of the extracellular-signal-regulated kinase.
16376338 2006 Protein kinase A phosphorylates and regulates dimerization of 14-3-3 epsilon.
16368544 2006 New insights into potential functions for the protein 4.1 superfamily of proteins in kidney epithelium.
16341674 2005 Transcriptome analysis of human gastric cancer.
16306228 2005 14-3-3 cooperates with LKB1 to regulate the activity and localization of QSK and SIK.
16246723 2005 Molecular basis for the recognition of phosphorylated and phosphoacetylated histone h3 by 14-3-3.
16223362 2006 Nur77 is phosphorylated in cells by RSK in response to mitogenic stimulation.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16123035 2005 C-terminal recognition by 14-3-3 proteins for surface expression of membrane receptors.
16114898 2005 14-3-3 Protein interacts with nuclear localization sequence of forkhead transcription factor FoxO4.
16045749 2005 BCR kinase phosphorylates 14-3-3 Tau on residue 233.
15964851 2005 Identification of the ankyrin repeat proteins ANKRA and RFXANK as novel partners of class IIa histone deacetylases.
15883165 2005 Sphingosine activates protein kinase A type II by a novel cAMP-independent mechanism.
15721295 2005 Phosphorylation-dependent binding of 14-3-3 to Par3beta, a human Par3-related cell polarity protein.
15696159 2005 JNK phosphorylation of 14-3-3 proteins regulates nuclear targeting of c-Abl in the apoptotic response to DNA damage.
15660133 2005 Interplay between components of a novel LIM kinase-slingshot phosphatase complex regulates cofilin.
15657067 2005 Phosphotyrosine signaling networks in epidermal growth factor receptor overexpressing squamous carcinoma cells.
15644438 2005 Melatonin synthesis: 14-3-3-dependent activation and inhibition of arylalkylamine N-acetyltransferase mediated by phosphoserine-205.
15629715 2005 MAPKAP kinase-2 is a cell cycle checkpoint kinase that regulates the G2/M transition and S phase progression in response to UV irradiation.
15616007 2005 HIV-1 accessory protein Vpr inhibits the effect of insulin on the Foxo subfamily of forkhead transcription factors by interfering with their binding to 14-3-3 proteins: potential clinical implications regarding the insulin resistance of HIV-1-infected patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15389569 2005 Altered regulation of EGF receptor signaling following a partial hepatectomy.
15364926 2004 Interactions between extracellular signal-regulated protein kinase 1, 14-3-3epsilon, and heat shock factor 1 during stress.
15363479 2004 An association study between polymorphisms in three genes of 14-3-3 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein) family and paranoid schizophrenia in northern Chinese population.
15347690 2004 14-3-3 protein C-terminal stretch occupies ligand binding groove and is displaced by phosphopeptide binding.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15324659 2004 aPKC acts upstream of PAR-1b in both the establishment and maintenance of mammalian epithelial polarity.
15314064 2004 Raf-1 activation disrupts its binding to keratins during cell stress.
15234461 2004 Examination of stress-related genes in human temporal versus occipital cortex in the course of neurodegeneration: involvement of 14-3-3 zeta in this dynamic process.
15229649 2004 Anchoring of both PKA and 14-3-3 inhibits the Rho-GEF activity of the AKAP-Lbc signaling complex.
15225635 2004 Identification of 14-3-3zeta as an EGF receptor interacting protein.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15159416 2004 A pathway of neuregulin-induced activation of cofilin-phosphatase Slingshot and cofilin in lamellipodia.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15073173 2004 14-3-3 binds to and mediates phosphorylation of microtubule-associated tau protein by Ser9-phosphorylated glycogen synthase kinase 3beta in the brain.
15071501 2004 JNK promotes Bax translocation to mitochondria through phosphorylation of 14-3-3 proteins.
15054037 2004 Identification of a novel 14-3-3zeta binding site within the cytoplasmic tail of platelet glycoprotein Ibalpha.
15037601 2004 YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta.
15036595 2004 Zeta 14-3-3 protein favours the formation of human tau fibrillar polymers.
15028637 2004 Protein 14-3-3zeta binds to protein phosphatase PP1gamma2 in bovine epididymal spermatozoa.
15023544 2004 Interaction of apoptosis signal-regulating kinase 1 with isoforms of 14-3-3 proteins.
14970201 2004 p21-activated kinase 1 phosphorylates and regulates 14-3-3 binding to GEF-H1, a microtubule-localized Rho exchange factor.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690436 2003 Two 14-3-3 binding motifs are required for stable association of Forkhead transcription factor FOXO4 with 14-3-3 proteins and inhibition of DNA binding.
14688280 2004 Dynamic changes in C-Raf phosphorylation and 14-3-3 protein binding in response to growth factor stimulation: differential roles of 14-3-3 protein binding sites.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
14578935 2003 Cellular stabilization of the melatonin rhythm enzyme induced by nonhydrolyzable phosphonate incorporation.
12963375 2003 Alternative splicing as a mechanism for regulating 14-3-3 binding: interactions between hD53 (TPD52L1) and 14-3-3 proteins.
12944463 2003 Protein phosphatase 2A dephosphorylation of phosphoserine 112 plays the gatekeeper role for BAD-mediated apoptosis.
12919677 2003 The MSP receptor regulates alpha6beta4 and alpha3beta1 integrins via 14-3-3 proteins in keratinocyte migration.
12865427 2003 The dimeric versus monomeric status of 14-3-3zeta is controlled by phosphorylation of Ser58 at the dimer interface.
12861023 2003 Proteomic identification of 14-3-3zeta as a mitogen-activated protein kinase-activated protein kinase 2 substrate: role in dimer formation and ligand binding.
12853467 2003 14-3-3s regulate fructose-2,6-bisphosphate levels by binding to PKB-phosphorylated cardiac fructose-2,6-bisphosphate kinase/phosphatase.
12819209 2003 Threonine 391 phosphorylation of the human prolactin receptor mediates a novel interaction with 14-3-3 proteins.
12766774 2003 Dual phosphorylation controls Cdc25 phosphatases and mitotic entry.
12764136 2003 14-3-3 acts as an intramolecular bridge to regulate cdc25B localization and activity.
12757707 2003 Interaction of Akt-phosphorylated ataxin-1 with 14-3-3 mediates neurodegeneration in spinocerebellar ataxia type 1.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12615066 2003 Characterization of zetin 1/rBSPRY, a novel binding partner of 14-3-3 proteins.
12589811 2003 The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12468542 2003 14-3-3beta binds to and negatively regulates the tuberous sclerosis complex 2 (TSC2) tumor suppressor gene product, tuberin.
12438239 2002 14-3-3 interacts with the tumor suppressor tuberin at Akt phosphorylation site(s).
12364343 2002 Regulation of TSC2 by 14-3-3 binding.
12361576 2002 14-3-3 regulates actin dynamics by stabilizing phosphorylated cofilin.
12323073 2003 Identification of cofilin and LIM-domain-containing protein kinase 1 as novel interaction partners of 14-3-3 zeta.
12215538 2002 Mitotic phosphorylation of chromosomal protein HMGN1 inhibits nuclear import and promotes interaction with 14.3.3 proteins.
12176995 2002 MADM, a novel adaptor protein that mediates phosphorylation of the 14-3-3 binding site of myeloid leukemia factor 1.
12176984 2002 Identification and characterization of the interaction between tuberin and 14-3-3zeta.
11985497 2002 RGS3 interacts with 14-3-3 via the N-terminal region distinct from the RGS (regulator of G-protein signalling) domain.
11956222 2002 Identification of 14-3-3zeta as a protein kinase B/Akt substrate.
11950841 2002 Selective association of protein kinase C with 14-3-3 zeta in neuronally differentiated PC12 Cells. Stimulatory and inhibitory effect of 14-3-3 zeta in vivo.
11917136 2002 Keratin binding to 14-3-3 proteins modulates keratin filaments and hepatocyte mitotic progression.
11912208 2002 Identification of epidermal growth factor receptor as a target of Cdc25A protein phosphatase.
11912194 2002 Insulin receptor substrate 4 associates with the protein IRAS.
11723239 2001 14-3-3 inhibits Bad-induced cell death through interaction with serine-136.
11697890 2001 Functional conservation of 14-3-3 isoforms in inhibiting bad-induced apoptosis.
11563969 2001 Chloride intracellular channel protein CLIC4 (p64H1) binds directly to brain dynamin I in a complex containing actin, tubulin and 14-3-3 isoforms.
11526496 2001 The growth-promoting activity of the Bad protein in chicken embryo fibroblasts requires binding to protein 14-3-3.
11504882 2001 Differential localization of HDAC4 orchestrates muscle differentiation.
11486037 2001 Histone deacetylase 4 possesses intrinsic nuclear import and export signals.
11427721 2001 Role of a pineal cAMP-operated arylalkylamine N-acetyltransferase/14-3-3-binding switch in melatonin synthesis.
11410287 2001 The proapoptotic protein Bad binds the amphipathic groove of 14-3-3zeta.
11359875 2001 Interaction of phosphorylated tyrosine hydroxylase with 14-3-3 proteins: evidence for a phosphoserine 40-dependent association.
11336675 2001 Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. a role for scaffolding in enzyme regulation.
11331285 2001 Modulation of the G protein regulator phosducin by Ca2+/calmodulin-dependent protein kinase II phosphorylation and 14-3-3 protein binding.
11287646 2001 Rethinking the role of phosducin: light-regulated binding of phosducin to 14-3-3 in rod inner segments.
11257119 2001 Atypical protein kinase C is involved in the evolutionarily conserved par protein complex and plays a critical role in establishing epithelia-specific junctional structures.
11237865 2001 Roles of the forkhead in rhabdomyosarcoma (FKHR) phosphorylation sites in regulating 14-3-3 binding, transactivation and nuclear targetting.
11178869 2001 Association of GABA(B) receptors and members of the 14-3-3 family of signaling proteins.
11124266 2001 Phosphatidylinositol 3-kinase signaling inhibits DAF-16 DNA binding and function via 14-3-3-dependent and 14-3-3-independent pathways.
10887173 2000 Calyculin A-induced vimentin phosphorylation sequesters 14-3-3 and displaces other 14-3-3 partners in vivo.
10864927 2000 An essential phosphorylation-site domain of human cdc25C interacts with both 14-3-3 and cyclins.
10840038 2000 14-3-3zeta is an effector of tau protein phosphorylation.
10785390 2000 Uncoupling proteins 2 and 3 interact with members of the 14.3.3 family.
10713667 2000 Specific interaction between 14-3-3 isoforms and the human CDC25B phosphatase.
10642536 2000 14-3-3zeta interacts with the alpha-chain of human interleukin 9 receptor.
10627461 2000 Cytoplasmic domains of GpIbalpha and GpIbbeta regulate 14-3-3zeta binding to GpIb/IX/V.
10611249 2000 Integration of calcium and cyclic AMP signaling pathways by 14-3-3.
10559254 1999 The kinesin-like motor protein KIF1C occurs in intact cells as a dimer and associates with proteins of the 14-3-3 family.
10488331 1999 Structural analysis of 14-3-3 phosphopeptide complexes identifies a dual role for the nuclear export signal of 14-3-3 in ligand binding.
10477722 1999 Identification of a 14-3-3 binding sequence in the common beta chain of the granulocyte-macrophage colony-stimulating factor (GM-CSF), interleukin-3 (IL-3), and IL-5 receptors that is serine-phosphorylated by GM-CSF.
10455159 1999 Nuclear localization of protein kinase U-alpha is regulated by 14-3-3.
10441394 1999 Phosphorylation-dependent association of the Ras-related GTP-binding protein Rem with 14-3-3 proteins.
10411906 1999 Suppression of apoptosis signal-regulating kinase 1-induced cell death by 14-3-3 proteins.
10407019 1999 alpha-Synuclein shares physical and functional homology with 14-3-3 proteins.
10224112 1999 The zeta isoform of 14-3-3 proteins interacts with the third intracellular loop of different alpha2-adrenergic receptor subtypes.
10102273 1999 Akt promotes cell survival by phosphorylating and inhibiting a Forkhead transcription factor.
10026197 1999 Cell adhesion regulates the interaction between the docking protein p130(Cas) and the 14-3-3 proteins.
9705322 1998 A novel sphingosine-dependent protein kinase (SDK1) specifically phosphorylates certain isoforms of 14-3-3 protein.
9620776 1998 ATM-dependent activation of p53 involves dephosphorylation and association with 14-3-3 proteins.
9581554 1997 14-3-3 proteins interact with the insulin-like growth factor receptor but not the insulin receptor.
9524113 1998 Phosphorylation of human keratin 18 serine 33 regulates binding to 14-3-3 proteins.
9512661 1998 Two unique 5' untranslated regions in mRNAs encoding human 14-3-3 zeta: differential expression in hemopoietic cells.
9454760 1998 Human signaling protein 14-3-3zeta interacts with platelet glycoprotein Ib subunits Ibalpha and Ibbeta.
9452471 1998 14-3-3 proteins interact with specific MEK kinases.
9428519 1997 The structural basis for 14-3-3:phosphopeptide binding specificity.
9425086 1998 Binding of purified 14-3-3 zeta signaling protein to discrete amino acid sequences within the cytoplasmic domain of the platelet membrane glycoprotein Ib-IX-V complex.
9398266 1997 Activation of the 43 kDa inositol polyphosphate 5-phosphatase by 14-3-3zeta.
9367879 1997 A c-Cbl yeast two hybrid screen reveals interactions with 14-3-3 isoforms and cytoskeletal components.
9360956 1997 14-3-3 is phosphorylated by casein kinase I on residue 233. Phosphorylation at this site in vivo regulates Raf/14-3-3 interaction.
9312143 1997 14-3-3 protein binds to insulin receptor substrate-1, one of the binding sites of which is in the phosphotyrosine binding domain.
9299557 1997 A20 inhibits NF-kappaB activation independently of binding to 14-3-3 proteins.
9197417 1997 The Cdk-like protein PCTAIRE-1 from mouse brain associates with p11 and 14-3-3 proteins.
9153224 1997 Raf-1 kinase and exoenzyme S interact with 14-3-3zeta through a common site involving lysine 49.
9144171 1997 Protein binding and signaling properties of RIN1 suggest a unique effector function.
8668348 1996 Identification of signalling proteins interacting with B-Raf in the yeast two-hybrid system.
8631758 1996 Identification of a binding sequence for the 14-3-3 protein within the cytoplasmic domain of the adhesion receptor, platelet glycoprotein Ib alpha.
8617504 1996 Assignment of the human genes encoding 14,3-3 Eta (YWHAH) to 22q12, 14-3-3 zeta (YWHAZ) to 2p25.1-p25.2, and 14-3-3 beta (YWHAB) to 20q13.1 by in situ hybridization.
8601312 1996 Interaction of 14-3-3 with signaling proteins is mediated by the recognition of phosphoserine.
8278375 1994 Histidine-367 of the human common beta chain of the receptor is critical for high-affinity binding of human granulocyte-macrophage colony-stimulating factor.
8101440 1993 Demonstration of the phosphorylation-dependent interaction of tryptophan hydroxylase with the 14-3-3 protein.
8085158 1994 Binding of 14-3-3 proteins to the protein kinase Raf and effects on its activation.
8037685 1994 Characterization of 14-3-3 proteins in adrenal chromaffin cells and demonstration of isoform-specific phospholipid binding.
8034572 1994 Association of a phospholipase A2 (14-3-3 protein) with the platelet glycoprotein Ib-IX complex.
7939633 1994 Association of the protein kinases c-Bcr and Bcr-Abl with proteins of the 14-3-3 family.
7939632 1994 Interaction of the protein kinase Raf-1 with 14-3-3 proteins.
7935795 1994 Activation of Raf-1 by 14-3-3 proteins.
7890696 1995 14-3-3 alpha and delta are the phosphorylated forms of raf-activating 14-3-3 beta and zeta. In vivo stoichiometric phosphorylation in brain at a Ser-Pro-Glu-Lys MOTIF.
7628630 1995 Characterization of the interaction of Raf-1 with ras p21 or 14-3-3 protein in intact cells.
7603574 1995 Crystal structure of the zeta isoform of the 14-3-3 protein.
7547034 1995 Molecular cloning of the 31 kDa cytosolic phospholipase A2, as an antigen recognized by the lung cancer-specific human monoclonal antibody, AE6F4.
7536343 1995 FAP-1: a protein tyrosine phosphatase that associates with Fas.
1577711 1992 Cloning and expression of a human 14-3-3 protein mediating phospholipolysis. Identification of an arachidonoyl-enzyme intermediate during catalysis.