Property Summary

NCBI Gene PubMed Count 322
PubMed Score 390.44
PubTator Score 161.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.031 3.5e-05
adult high grade glioma -2.100 8.5e-06
astrocytic glioma -1.400 2.9e-02
Astrocytoma, Pilocytic -1.700 1.8e-06
atypical teratoid / rhabdoid tumor -2.200 2.8e-08
Breast cancer 1.100 1.2e-04
breast carcinoma 2.200 2.9e-03
ependymoma -2.000 3.2e-02
glioblastoma -1.700 6.4e-08
group 4 medulloblastoma -2.000 1.3e-05
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
invasive ductal carcinoma 1.200 3.8e-03
lung adenocarcinoma 1.166 1.5e-07
lung cancer -1.200 3.6e-03
medulloblastoma, large-cell -2.400 5.8e-05
Multiple myeloma 2.045 1.6e-03
oligodendroglioma -1.800 3.4e-02
ovarian cancer 2.500 1.4e-04
pancreatic ductal adenocarcinoma liver m... 1.308 1.5e-03
Parkinson's disease -1.100 4.6e-02
primitive neuroectodermal tumor -1.500 4.6e-04

Protein-protein Interaction (2)

PDB (30)

Gene RIF (137)

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE      1 - 70
GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKG     71 - 140
IVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEES    141 - 210
YKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN                                       211 - 245
//

Text Mined References (344)

PMID Year Title