Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.424 5.5e-03
ependymoma 1.600 1.0e-02
oligodendroglioma 1.400 1.4e-02
osteosarcoma 3.058 1.8e-05
atypical teratoid / rhabdoid tumor 1.900 7.9e-06
glioblastoma 2.100 2.5e-05
medulloblastoma 1.700 1.8e-03
medulloblastoma, large-cell 2.400 1.2e-05
primitive neuroectodermal tumor 1.100 8.5e-04
pediatric high grade glioma 1.200 1.4e-02
aldosterone-producing adenoma -1.873 2.5e-02
breast carcinoma 1.200 1.2e-10
invasive ductal carcinoma 1.300 2.6e-02
ovarian cancer -1.100 5.8e-04

Gene RIF (2)

PMID Text
22190034 HIV-1 NC is identified to have a physical interaction with YTH domain family, member 3 (YTHDF3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20463905 Includes a multi-species analysis of YTHDF family members.

AA Sequence

MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQSNSYPPMSDPYMPSYYAPSIGFPYS      1 - 70
LGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQHGFNFFPGNADFSTWGTSG     71 - 140
SQGQSTQSSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSKVPGISSIEQGMTGLKIGGDLTAAVTKTVGT    141 - 210
ALSSSGMTSIATNSVPPVSSAAPKPTSWAAIARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWD    211 - 280
EKGSVVKAPPTQPVLPPQTIIQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQPQQQQL    281 - 350
QNRWVAPRNRGAGFNQNNGAGSENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFI    351 - 420
IKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAG    421 - 490
VWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIF    491 - 560
DDFAHYEKRQEEEEAMRRERNRNKQ                                                 561 - 585
//

Text Mined References (25)

PMID Year Title
26458103 2015 Dynamic m(6)A mRNA methylation directs translational control of heat shock response.
24284625 2014 N6-methyladenosine-dependent regulation of messenger RNA stability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22575960 2012 Topology of the human and mouse m6A RNA methylomes revealed by m6A-seq.
22194214 2012 Replication study of 10 genes showing evidence for association with multiple sclerosis: validation of TMEM39A, IL12B and CBLB [correction of CLBL] genes.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20463905 2010 Concomitant duplications of opioid peptide and receptor genes before the origin of jawed vertebrates.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12368078 2002 YTH: a new domain in nuclear proteins.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.