Property Summary

NCBI Gene PubMed Count 29
PubMed Score 16.96
PubTator Score 15.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.508 2.2e-03
osteosarcoma -2.006 8.6e-07
juvenile dermatomyositis 1.010 6.7e-10
Amyotrophic Lateral Sclerosis 1.024 3.5e-06
acute quadriplegic myopathy 1.072 9.5e-05
tuberculosis and treatment for 6 months 1.200 8.1e-03
spina bifida -1.251 4.4e-02
Breast cancer -1.100 5.1e-12
ovarian cancer -1.700 1.7e-07
dermatomyositis 1.100 2.9e-04

Gene RIF (7)

PMID Text
26876937 Results show that YTHDC1 promotes exon inclusion in targeted mRNAs through recruiting pre-mRNA splicing factor SRSF3 while blocking SRSF10 mRNA binding.
25242552 The YTHDC1-binding sites and biochemical experiments, not only reveal the specific mode of m(6)A-YTH binding but also explain the preferential recognition of the GG(m(6)A)C sequences by YTHDC1.
23865345 Studied mRNA levels of FOXO1, KLF9 and YT521 in human normal and cancerous endometrial tissue. A remarkable (not significant, p = 0.069) increase was found in the YT521 mRNA level of patients' endometrial tissue in comparison with the control subjects.
23765422 Hypoxia induces a specific switch in YT521 expression pattern towards the two non-protein coding mRNA variants, the already characterized isoform 3 and the newly discovered exon 8-skipping isoform.
20686370 Lack of YT521 protein is associated with endometrial cancer.
15175272 phosphorylation causes sequestration of YT521-B in an insoluble nuclear form, which is unable to change splice sites
12755701 YT521-B has a role in a gene expression in the pathogenesis of Emery-Dreifuss muscular dystrophy

AA Sequence

MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLV      1 - 70
SKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDP     71 - 140
ERRAKSPTPDGSERIGLEVDRRASRSSQSSKEEVNSEEYGSDHETGSSGSSDEQGNNTENEEEGVEEDVE    141 - 210
EDEEVEEDAEEDEEVDEDGEEEEEEEEEEEEEEEEEEEEYEQDERDQKEEGNDYDTRSEASDSGSESVSF    211 - 280
TDGSVRSGSGTDGSDEKKKERKRARGISPIVFDRSGSSASESYAGSEKKHEKLSSSVRAVRKDQTSKLKY    281 - 350
VLQDARFFLIKSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRSARSVILIFSVRESGKFQGFARLSSESH    351 - 420
HGGSPIHWVLPAGMSAKMLGGVFKIDWICRRELPFTKSAHLTNPWNEHKPVKIGRDGQEIELECGTQLCL    421 - 490
LFPPDESIDLYQVIHKMRHKRRMHSQPRSRGRPSRREPVRDVGRRRPEDYDIHNSRKKPRIDYPPEFHQR    491 - 560
PGYLKDPRYQEVDRRFSGVRRDVFLNGSYNDYVREFHNMGPPPPWQGMPPYPGMEQPPHHPYYQHHAPPP    561 - 630
QAHPPYSGHHPVPHEARYRDKRVHDYDMRVDDFLRRTQAVVSGRRSRPRERDRERERDRPRDNRRDRERD    631 - 700
RGRDRERERERLCDRDRDRGERGRYRR                                               701 - 727
//

Text Mined References (37)

PMID Year Title
26876937 2016 Nuclear m(6)A Reader YTHDC1 Regulates mRNA Splicing.
26318451 2015 Structural Basis for the Discriminative Recognition of N6-Methyladenosine RNA by the Human YT521-B Homology Domain Family of Proteins.
25416956 2014 A proteome-scale map of the human interactome network.
25242552 2014 Structural basis for selective binding of m6A RNA by the YTHDC1 YTH domain.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23865345 2013 The evaluation of the FOXO1, KLF9 and YT521 genes expression in human endometrial cancer.
23765422 2014 Hypoxia-dependent mRNA expression pattern of splicing factor YT521 and its impact on oncological important target gene expression.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20686370 2010 Alternative splicing-related factor YT521: an independent prognostic factor in endometrial cancer.
20167602 2010 The YTH domain is a novel RNA binding domain.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19282290 2009 Heterogeneous nuclear ribonucleoprotein G regulates splice site selection by binding to CC(A/C)-rich regions in pre-mRNA.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15175272 2004 The intranuclear localization and function of YT521-B is regulated by tyrosine phosphorylation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12755701 2003 Emerin interacts in vitro with the splicing-associated factor, YT521-B.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12368078 2002 YTH: a new domain in nuclear proteins.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.
10973987 2000 The ER repeat protein YT521-B localizes to a novel subnuclear compartment.
10564280 1999 The interaction and colocalization of Sam68 with the splicing-associated factor YT521-B in nuclear dots is regulated by the Src family kinase p59(fyn).