Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.89
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.800 5.3e-03
posterior fossa group B ependymoma -3.100 3.2e-11
glioblastoma -3.300 6.8e-07
osteosarcoma -4.952 1.2e-08
medulloblastoma -2.300 4.4e-04
atypical teratoid / rhabdoid tumor -4.000 2.6e-12
medulloblastoma, large-cell -4.500 6.4e-09
primitive neuroectodermal tumor -2.400 5.5e-04
tuberculosis -3.100 5.5e-10
breast carcinoma -1.100 4.6e-04
pediatric high grade glioma -2.700 1.3e-06
pilocytic astrocytoma -1.800 2.1e-06
subependymal giant cell astrocytoma -3.177 5.1e-03
Pick disease -1.600 4.8e-04
pituitary cancer -1.800 1.6e-05

Synonym

Accession Q96NS1 B3KW92 Q2M3U7 Q65Z98
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20555386 Data show that major vault protein (MVP), a lung resistance associated protein, is a binding partner of YPEL4.
20508983 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPSCDPGPGPACLPTKTFRSYLPRCHRTYSCVHCRAHLAKHDELISKSFQGSHGRAYLFNSVVNVGCGPA      1 - 70
EQRLLLTGLHSVADIFCESCKTTLGWKYEQAFETSQKYKEGKYIIEMSHMVKDNGWD                  71 - 127
//

Text Mined References (7)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
20555386 2010 MVP interacts with YPEL4 and inhibits YPEL4-mediated activities of the ERK signal pathway.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
15556292 2004 Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.