Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.75
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute myeloid leukemia 1.200 3.9e-02
adult high grade glioma -1.800 3.6e-05
astrocytic glioma -1.900 1.4e-02
Astrocytoma, Pilocytic -1.300 5.6e-06
atypical teratoid / rhabdoid tumor -2.400 1.1e-06
cystic fibrosis -1.642 2.9e-05
ependymoma -1.900 2.5e-02
glioblastoma -1.500 4.5e-07
group 4 medulloblastoma 1.100 1.7e-02
medulloblastoma, large-cell -1.300 5.4e-03
oligodendroglioma -1.400 4.1e-02
osteosarcoma -1.979 3.2e-04
ovarian cancer -2.100 1.4e-17
primitive neuroectodermal tumor -1.500 5.5e-04
spina bifida -1.376 4.5e-02
subependymal giant cell astrocytoma -1.369 2.7e-02
tuberculosis and treatment for 6 months 1.300 5.8e-06

Synonym

Accession Q96QA6 A0PK16 A2RUG4 Q65ZA0 Q8N3W2
Symbols FKSG4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MVKMTRSKTFQAYLPSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTG      1 - 70
LHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKYIIELAHMIKDNGWD                          71 - 119
//

Text Mined References (9)

PMID Year Title