Property Summary

NCBI Gene PubMed Count 20
PubMed Score 36.79
PubTator Score 28.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2798 7.9e-19
psoriasis 6685 7.1e-08
glioblastoma 5572 1.7e-05
Multiple myeloma 1327 7.4e-05
non primary Sjogren syndrome sicca 840 3.2e-02
lung cancer 4473 3.6e-02
Disease Target Count Z-score Confidence
Vici syndrome 16 4.665 2.3

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.393 7.4e-05
psoriasis 1.400 7.1e-08
glioblastoma 1.300 1.7e-05
non-small cell lung cancer 1.536 7.9e-19
lung cancer 1.400 3.6e-02
non primary Sjogren syndrome sicca 1.100 3.2e-02

Protein-protein Interaction (4)

Gene RIF (4)

PMID Text
16821082 mRNA expression of CCT5, RGS3, and YKT6 was significantly up-regulated in p53-mutated tumors and associated with a low response rate to docetaxel.
14607937 N-ethylmaleimide-sensitive factor-dependent SNARE-priming complex disassembly is required for efficient exocytosis from mast cells.
12388752 Data suggest that GS15 exists in a distinct SNARE complex that contains syntaxin5, GS28, and Ykt6, and may be involved in both ER-to-Golgi and intra-Golgi transport.
11884350 abnormalities in the SNARE complex could represent a molecular substrate for abnormalities of neural connectivity in severe mental disorders

AA Sequence

MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKGTRASVKEQDYLCHVYV      1 - 70
RNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQNPREADPMT     71 - 140
KVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM                141 - 198
//

Text Mined References (25)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16821082 2007 Possible involvement of CCT5, RGS3, and YKT6 genes up-regulated in p53-mutated tumors in resistance to docetaxel in human breast cancers.
16354670 2006 Involvement of a novel Q-SNARE, D12, in quality control of the endomembrane system.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15544955 2004 Longins and their longin domains: regulated SNAREs and multifunctional SNARE regulators.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479160 2004 The human SNARE protein Ykt6 mediates its own palmitoylation at C-terminal cysteine residues.
15215310 2004 Participation of the syntaxin 5/Ykt6/GS28/GS15 SNARE complex in transport from the early/recycling endosome to the trans-Golgi network.
15044687 2004 Localization and activity of the SNARE Ykt6 determined by its regulatory domain and palmitoylation.
14742712 2004 Countercurrent distribution of two distinct SNARE complexes mediating transport within the Golgi stack.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14607937 2003 Mast cell degranulation requires N-ethylmaleimide-sensitive factor-mediated SNARE disassembly.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388752 2002 GS15 forms a SNARE complex with syntaxin 5, GS28, and Ykt6 and is implicated in traffic in the early cisternae of the Golgi apparatus.
11927603 2002 Sequential tethering of Golgins and catalysis of SNAREpin assembly by the vesicle-tethering protein p115.
11474112 2001 An autoinhibitory mechanism for nonsyntaxin SNARE proteins revealed by the structure of Ykt6p.
9211930 1997 Ykt6p, a prenylated SNARE essential for endoplasmic reticulum-Golgi transport.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.