Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.20
PubTator Score 1.58

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.700 3.4e-06
astrocytic glioma -2.200 3.9e-03
Astrocytoma, Pilocytic -2.200 1.5e-06
atypical teratoid / rhabdoid tumor -2.700 2.5e-09
ependymoma -2.200 7.5e-03
glioblastoma -1.900 4.9e-07
group 4 medulloblastoma -2.200 1.1e-04
medulloblastoma, large-cell -3.100 5.1e-07
oligodendroglioma -1.900 1.0e-02
Pick disease -1.100 1.2e-03
primitive neuroectodermal tumor -1.900 5.3e-04

 Compartment GO Term (1)

AA Sequence

MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQS      1 - 70
TAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGAVGLVCARHL     71 - 140
RVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPC    141 - 210
TRALATLKLLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVR    211 - 280
RKFALRLPGYTGTDCVAAL                                                       281 - 299
//

Text Mined References (6)

PMID Year Title