Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.41
PubTator Score 3.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.200 2.1e-06
psoriasis 1.300 1.3e-04
osteosarcoma -2.449 7.1e-08
medulloblastoma, large-cell -1.200 5.7e-04
tuberculosis and treatment for 6 months -1.400 1.9e-06
intraductal papillary-mucinous adenoma (... 1.200 2.8e-02
intraductal papillary-mucinous carcinoma... 1.400 2.9e-02
lung cancer -1.500 1.0e-03
group 3 medulloblastoma 1.200 4.8e-04
Breast cancer 1.200 7.6e-18
ovarian cancer 1.700 2.1e-05

AA Sequence

MAEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDLKAVG      1 - 70
KKFMHVLYPRKSNTLLRDWDLWGPLILCVTLALMLQRDSADSEKDGGPQFAEVFVIVWFGAVTITLNSKL     71 - 140
LGGNISFFQSLCVLGYCILPLTVAMLICRLVLLADPGPVNFMVRLFVVIVMFAWSIVASTAFLADSQPPN    141 - 210
RRALAVYPVFLFYFVISWMILTFTPQ                                                211 - 236
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.