Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.92
PubTator Score 8.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia -1.200 4.6e-02
acute quadriplegic myopathy 1.045 8.6e-05
astrocytic glioma -1.100 4.8e-02
Breast cancer 3.000 2.8e-02
diabetes mellitus -1.100 3.0e-03
glioblastoma 1.200 6.7e-03
group 3 medulloblastoma 1.500 2.7e-02
hepatocellular carcinoma 1.600 4.0e-05
juvenile dermatomyositis 1.223 6.0e-11
lung adenocarcinoma 1.292 3.9e-04
osteosarcoma 1.382 5.7e-03
ovarian cancer -1.300 6.2e-04
pancreatic cancer 1.200 1.9e-02
pancreatic carcinoma 1.200 1.9e-02
primary pancreatic ductal adenocarcinoma 1.430 1.8e-03
psoriasis -2.100 3.3e-05
sarcoidosis 1.100 1.2e-02
tuberculosis -1.600 3.0e-08

Gene RIF (9)

AA Sequence

MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPT      1 - 70
QAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNETDLAGPMVFCLAFGAT     71 - 140
LLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVIFSLQGMVGII    141 - 210
LTAGIIGWCSFSASKIFISALAMEGQQLLVAYPCALLYGVFALISVF                           211 - 257
//

Text Mined References (25)

PMID Year Title