Property Summary

NCBI Gene PubMed Count 21
PubMed Score 16.05
PubTator Score 8.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
hepatocellular carcinoma 1.600 4.0e-05
pancreatic cancer 1.200 1.9e-02
astrocytic glioma -1.400 1.9e-02
psoriasis -2.100 3.3e-05
osteosarcoma 1.382 5.7e-03
glioblastoma 1.200 6.7e-03
juvenile dermatomyositis 1.226 8.0e-08
acute quadriplegic myopathy 1.300 1.2e-06
primary pancreatic ductal adenocarcinoma 1.430 1.8e-03
tuberculosis and treatment for 6 months -3.100 7.8e-07
sarcoidosis 1.100 1.2e-02
diabetes mellitus -1.100 3.0e-03
Breast cancer 3.000 2.8e-02
group 3 medulloblastoma 1.500 2.7e-02
pancreatic carcinoma 1.200 1.9e-02
lung adenocarcinoma 1.292 3.9e-04
acute myeloid leukemia -1.200 4.6e-02
ovarian cancer 2.300 1.2e-04

Gene RIF (8)

PMID Text
25742138 we propose a model for intracellular Brucella replication that exploits the host unfolded protein response and endoplasmic reticulum -derived vacuole formation machineries, both of which depend on Yip1A-mediated IRE1 activation.
23342155 Findings suggest that the ability of Yip1A to bind its established binding partners may be uncoupled from its ability to control ER whorl formation.
20237155 Results reveal a conserved Yip1A-mediated mechanism for ER membrane organization that may serve to regulate cargo exit from the organelle.
19845895 Observational study of gene-disease association. (HuGE Navigator)
19509059 These results suggested that Yip1A has a role in COPI-independent retrograde transport from the Golgi to the ER and regulates the membrane recruitment of Rab6.
18718466 YIPF5 is not restricted to Endoplasmic Reticulum exit sites but also localized in the ER-Golgi intermediate compartment (ERGIC) and some in the cis-Golgi at steady state
15990086 Human Yip1A (YIPF5) interacts with and localizes human Yif1 (YIF1A) to the Golgi apparatus.
15922870 The highest level of expression was found in coronary smooth muscle cells, in which expression of the SMAP-5 gene was induced by transforming growth factor beta1, thus indicating that this protein may play an important role in inflammation.

AA Sequence

MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPT      1 - 70
QAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNETDLAGPMVFCLAFGAT     71 - 140
LLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVIFSLQGMVGII    141 - 210
LTAGIIGWCSFSASKIFISALAMEGQQLLVAYPCALLYGVFALISVF                           211 - 257
//

Text Mined References (24)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25742138 2015 Yip1A, a novel host factor for the activation of the IRE1 pathway of the unfolded protein response during Brucella infection.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23736259 2013 The ALS8 protein VAPB interacts with the ER-Golgi recycling protein YIF1A and regulates membrane delivery into dendrites.
23342155 2013 Identification of discrete sites in Yip1A necessary for regulation of endoplasmic reticulum structure.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20237155 2010 Yip1A structures the mammalian endoplasmic reticulum.
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
19509059 2009 Yip1A regulates the COPI-independent retrograde transport from the Golgi complex to the ER.
18718466 2008 YIPF5 and YIF1A recycle between the ER and the Golgi apparatus and are involved in the maintenance of the Golgi structure.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15990086 2005 Human Yip1A specifies the localization of Yif1 to the Golgi apparatus.
15922870 2005 Cloning, cellular localization, genomic organization, and tissue-specific expression of the TGFbeta1-inducible SMAP-5 gene.
15611160 2004 Genetic analysis of yeast Yip1p function reveals a requirement for Golgi-localized rab proteins and rab-Guanine nucleotide dissociation inhibitor.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11489904 2001 A membrane protein enriched in endoplasmic reticulum exit sites interacts with COPII.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.