Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.30
PubTator Score 4.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.100 4.4e-04
Astrocytoma, Pilocytic 1.100 3.2e-05
atypical teratoid / rhabdoid tumor -1.400 8.3e-06
glioblastoma 1.100 1.1e-05
hepatocellular carcinoma 1.100 1.8e-03
osteosarcoma -1.632 3.7e-05
tuberculosis -1.300 6.6e-04

Gene RIF (3)

AA Sequence

MQPPGPPPAYAPTNGDFTFVSSADAEDLSGSIASPDVKLNLGGDFIKESTATTFLRQRGYGWLLEVEDDD      1 - 70
PEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWI     71 - 140
ITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPLIVIAPVLLVVGSFEVVSTLIKLFGVFWAAYSA    141 - 210
ASLLVGEEFKTKKPLLIYPIFLLYIYFLSLYTGV                                        211 - 244
//

Text Mined References (16)

PMID Year Title