Property Summary

NCBI Gene PubMed Count 9
PubMed Score 29.48
PubTator Score 13.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.200 3.0e-06
psoriasis -1.900 4.7e-05

 GO Function (1)

AA Sequence

MASADELTFHEFEEATNLLADTPDAATTSRSDQLTPQGHVAVAVGSGGSYGAEDEVEEESDKAALLQEQQ      1 - 70
QQQQPGFWTFSYYQSFFDVDTSQVLDRIKGSLLPRPGHNFVRHHLRNRPDLYGPFWICATLAFVLAVTGN     71 - 140
LTLVLAQRRDPSIHYSPQFHKVTVAGISIYCYAWLVPLALWGFLRWRKGVQERMGPYTFLETVCIYGYSL    141 - 210
FVFIPMVVLWLIPVPWLQWLFGALALGLSAAGLVFTLWPVVREDTRLVATVLLSVVVLLHALLAMGCKLY    211 - 280
FFQSLPPENVAPPPQITSLPSNIALSPTLPQSLAPS                                      281 - 316
//

Text Mined References (11)

PMID Year Title