Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.43
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
oligodendroglioma 1.200 4.4e-02
psoriasis 2.200 1.2e-05
astrocytoma 1.200 1.2e-02
glioblastoma 1.200 2.1e-02
osteosarcoma 1.153 1.4e-02
medulloblastoma, large-cell 1.100 1.6e-04
pancreatic ductal adenocarcinoma liver m... -1.140 3.9e-02
pilocytic astrocytoma 1.100 3.8e-07
posterior fossa group B ependymoma 1.200 1.7e-12
lung adenocarcinoma 1.200 3.2e-05
ovarian cancer 2.300 1.3e-05

Gene RIF (2)

PMID Text
18718466 YIF1A is involved in the maintenance of the Golgi structure.
15990086 Human Yip1A (YIPF5) interacts with and localizes human Yif1 (YIF1A) to the Golgi apparatus.

AA Sequence

MAYHSGYGAHGSKHRARAAPDPPPLFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGSSI      1 - 70
ASHGKDMVHKELHRFVSVSKLKYFFAVDTAYVAKKLGLLVFPYTHQNWEVQYSRDAPLPPRQDLNAPDLY     71 - 140
IPTMAFITYVLLAGMALGIQKRFSPEVLGLCASTALVWVVMEVLALLLGLYLATVRSDLSTFHLLAYSGY    141 - 210
KYVGMILSVLTGLLFGSDGYYVALAWTSSALMYFIVRSLRTAALGPDSMGGPVPRQRLQLYLTLGAAAFQ    211 - 280
PLIIYWLTFHLVR                                                             281 - 293
//

Text Mined References (20)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
23736259 2013 The ALS8 protein VAPB interacts with the ER-Golgi recycling protein YIF1A and regulates membrane delivery into dendrites.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22645275 2012 Identification of novel ATP13A2 interactors and their role in ?-synuclein misfolding and toxicity.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
18718466 2008 YIPF5 and YIF1A recycle between the ER and the Golgi apparatus and are involved in the maintenance of the Golgi structure.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15990086 2005 Human Yip1A specifies the localization of Yif1 to the Golgi apparatus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308636 2004 Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11943201 2002 Identification of the novel proteins Yip4p and Yip5p as Rab GTPase interacting factors.
11099500 2001 Interaction of the type IIa Na/Pi cotransporter with PDZ proteins.
10970842 2000 A novel Golgi membrane protein is part of a GTPase-binding protein complex involved in vesicle targeting.
8824393 1995 The GDP/GTP cycle of Rab5 in the regulation of endocytotic membrane traffic.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.